ANTIBODY AND ELISA PROMOS

20% off all ELISAs • Two for the price of one on select antibodies.

Don’t miss out on these great offers! Learn More Here.

Catalog No: OAAF08038
Size:100 ug
Price: $329.00
SKU
OAAF08038
Availability: Domestic: within 1 week delivery | International: 1 week
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for OAAF08038
Product Info
Predicted Species ReactivityHuman, Mouse, Rat
Product FormatLiquid(without Mg2+ and Ca2+) (pH 7.4), 150mM NaCl, 0.02% sodium azide and 50% glycerol
ClonalityPolyclonal
IsotypeIgG
HostRabbit
ApplicationWB, ELISA
Reconstitution and StorageStable at -20C for at least 1 year.
ImmunogenThe antiserum was produced against synthesized peptide derived between 461-510 amino acids from the Internal region of human GPC3.
PurificationThe antibody was affinity-purified from rabbit antiserum by affinity-chromatography using peptide.
Peptide SequenceSynthetic peptide located within the following region: QIIDKLKHINQLLRTMSMPKGRVLDKNLDEEGFESGDCGDDEDECIGGSG
Concentration1 mg/ml
SpecificityGPC3 Antibody detects endogenous levels of GPC3 protein.
Application InfoWB: 1:500~1000
ELISA: 1:10000
Gene SymbolGPC3
Alias SymbolsSGB, DGSX, MXR7, SDYS, SGBS, OCI-5, SGBS1, GTR2-2
NCBI Gene Id2719
Uniprot IDP51654
Molecular Weight65 kDa
  1. What is the species homology for "GPC3 Antibody (OAAF08038)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat".

  2. How long will it take to receive "GPC3 Antibody (OAAF08038)"?

    This item is available "Domestic: within 1 week delivery | International: 1 week".

  3. What buffer format is "GPC3 Antibody (OAAF08038)" provided in?

    This item is provided in "Liquid(without Mg2+ and Ca2+) (pH 7.4), 150mM NaCl, 0.02% sodium azide and 50% glycerol ".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "GPC3 Antibody (OAAF08038)"?

    This target may also be called "SGB, DGSX, MXR7, SDYS, SGBS, OCI-5, SGBS1, GTR2-2" in publications.

  5. What is the shipping cost for "GPC3 Antibody (OAAF08038)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "GPC3 Antibody (OAAF08038)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "GPC3 Antibody (OAAF08038)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "65 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "GPC3 Antibody (OAAF08038)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "GPC3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "GPC3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "GPC3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "GPC3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "GPC3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "GPC3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:GPC3 Antibody (OAAF08038)
Your Rating
We found other products you might like!