GPC3 Antibody - middle region : HRP (ARP37665_T100-HRP)

Catalog No: ARP37665_T100-HRP

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: HRP: Horseradish Peroxidase
• Application: IHC, WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GPC3
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: FSTIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYRSAYYPEDLFIDKKVL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-GPC3 (ARP37665_T100-HRP) antibody is Catalog # AAP37665 (Previous Catalog # AAPP08963)
• Reference: Boily,G., et al., (2004) Br. J. Cancer 90 (8), 1606-1611
• Publications:

  Bhave, V. S. et al. Regulation of liver growth by glypican 3, CD81, hedgehog, and Hhex. Am. J. Pathol. 183, 153-9 (2013). WB, Mouse, Human, Dog, Pig, Horse, Rabbit, Guinea pig, Rat, Bovine 23665349

Target Info

• Gene Symbol: GPC3
• Gene Full Name: Glypican 3
• Alias Symbols: SGB, DGSX, MXR7, SDYS, SGBS, OCI-5, SGBS1, GTR2-2
• NCBI Gene Id: 2719
• Protein Name: Glypican-3
• Description of Target: Cell surface heparan sulfate proteoglycans are composed of a membrane-associated protein core substituted with a variable number of heparan sulfate chains. Members of the glypican-related integral membrane proteoglycan family (GRIPS) contain a core protein anchored to the cytoplasmic membrane via a glycosyl phosphatidylinositol linkage. These proteins may play a role in the control of cell division and growth regulation. Deletion mutations in this gene are associated with Simpson-Golabi-Behmel syndrome.
• Uniprot ID: P51654
• Protein Accession #: NP_004475
• Nucleotide Accession #: NM_004484
• Protein Size (# AA): 580
• Molecular Weight: 64kDa
• Protein Interactions: UBC; WNT3A; WNT7B; IGF2; FGF2;