Size:100 ul
In stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP37665_T100-FITC Conjugated

ARP37665_T100-HRP Conjugated

ARP37665_T100-Biotin Conjugated

GPC3 Antibody - middle region (ARP37665_T100)

Catalog#: ARP37665_T100
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-34095, HPA006316
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human GPC3
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data Anti-GPC3 (ARP37665_T100)
Peptide Sequence Synthetic peptide located within the following region: FSTIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYRSAYYPEDLFIDKKVL
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-GPC3 (ARP37665_T100) antibody is Catalog # AAP37665 (Previous Catalog # AAPP08963)
Datasheets/Manuals Printable datasheet for anti-GPC3 (ARP37665_T100) antibody
Target Reference Boily,G., et al., (2004) Br. J. Cancer 90 (8), 1606-1611

Bhave, V. S. et al. Regulation of liver growth by glypican 3, CD81, hedgehog, and Hhex. Am. J. Pathol. 183, 153-9 (2013). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 23665349

Gene Symbol GPC3
Official Gene Full Name Glypican 3
Alias Symbols SGB, DGSX, MXR7, SDYS, SGBS, OCI-5, SGBS1, GTR2-2
NCBI Gene Id 2719
Protein Name Glypican-3
Description of Target Cell surface heparan sulfate proteoglycans are composed of a membrane-associated protein core substituted with a variable number of heparan sulfate chains. Members of the glypican-related integral membrane proteoglycan family (GRIPS) contain a core protein anchored to the cytoplasmic membrane via a glycosyl phosphatidylinositol linkage. These proteins may play a role in the control of cell division and growth regulation. Deletion mutations in this gene are associated with Simpson-Golabi-Behmel syndrome.
Swissprot Id P51654
Protein Accession # NP_004475
Nucleotide Accession # NM_004484
Protein Size (# AA) 580
Molecular Weight 64kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express GPC3.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express GPC3.
Protein Interactions UBC; WNT3A; WNT7B; IGF2; FGF2;
Write Your Own Review
You're reviewing:GPC3 Antibody - middle region (ARP37665_T100)
Your Rating