Now Offering Over 102,157 Antibodies & 44,722 Antigens!

GPC3 antibody - middle region (ARP37665_T100)

100 ul
$249.00
In Stock

Conjugation Options

ARP37665_T100-FITC Conjugated

ARP37665_T100-HRP Conjugated

ARP37665_T100-Biotin Conjugated

Gene Symbol:
GPC3
NCBI Gene Id:
2719
Official Gene Full Name:
Glypican 3
Protein Name:
Glypican-3
Swissprot Id:
P51654
Protein Accession #:
NP_004475
Nucleotide Accession #:
NM_004484
Alias Symbols:
SGB, DGSX, MXR7, SDYS, SGBS, OCI-5, SGBS1, GTR2-2
Replacement Item:
This antibody may replace item sc-34095, HPA006316
Description of Target:
Cell surface heparan sulfate proteoglycans are composed of a membrane-associated protein core substituted with a variable number of heparan sulfate chains. Members of the glypican-related integral membrane proteoglycan family (GRIPS) contain a core protein anchored to the cytoplasmic membrane via a glycosyl phosphatidylinositol linkage. These proteins may play a role in the control of cell division and growth regulation. Deletion mutations in this gene are associated with Simpson-Golabi-Behmel syndrome.
Protein Size (# AA):
580
Molecular Weight:
64kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GPC3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GPC3.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human GPC3
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-GPC3 (ARP37665_T100)
Peptide Sequence:
Synthetic peptide located within the following region: FSTIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYRSAYYPEDLFIDKKVL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; WNT3A; WNT7B; IGF2; FGF2;
Blocking Peptide:
For anti-GPC3 (ARP37665_T100) antibody is Catalog # AAP37665 (Previous Catalog # AAPP08963)
Datasheets/Manuals:
Printable datasheet for anti-GPC3 (ARP37665_T100) antibody
Target Reference:
Boily,G., et al., (2004) Br. J. Cancer 90 (8), 1606-1611
Publications:

Bhave, V. S. et al. Regulation of liver growth by glypican 3, CD81, hedgehog, and Hhex. Am. J. Pathol. 183, 153-9 (2013). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 23665349

Tell us what you think about this item!

Write A Review
    Please, wait...