Catalog No: ARP46363_P050-FITC
Size:100ul
Price: $434.00
SKU
ARP46363_P050-FITC
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

GPAA1 Antibody - C-terminal region : FITC (ARP46363_P050-FITC)

Datasheets/ManualsPrintable datasheet for anti-GPAA1 (ARP46363_P050-FITC) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC: Fluorescein Isothiocyanate
ApplicationWB, IHC
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human GPAA1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: LGSLFLWRELQEAPLSLAEGWQLFLAALAQGVLEHHTYGALLFPLLSLGL
Concentration0.5 mg/ml
Blocking PeptideFor anti-GPAA1 (ARP46363_P050-FITC) antibody is Catalog # AAP46363 (Previous Catalog # AAPP27149)
ReferenceVainauskas,S. (2005) J. Biol. Chem. 280 (16), 16402-16409
Gene SymbolGPAA1
Gene Full NameGlycosylphosphatidylinositol anchor attachment protein 1 homolog (yeast)
Alias SymbolsGAA1, hGAA1, GPIBD15
NCBI Gene Id8733
Protein NameGlycosylphosphatidylinositol anchor attachment 1 protein
Description of TargetPosttranslational glycosylphosphatidylinositol (GPI) anchor attachment serves as a general mechanism for linking proteins to the cell surface membrane. GPAA1 presumably functions in GPI anchoring at the GPI transfer step. The anchor attachment protein 1 contains an N-terminal signal sequence, 1 cAMP- and cGMP-dependent protein kinase phosphorylation site, 1 leucine zipper pattern, 2 potential N-glycosylation sites, and 8 putative transmembrane domains.Posttranslational glycosylphosphatidylinositol (GPI) anchor attachment serves as a general mechanism for linking proteins to the cell surface membrane. The protein encoded by this gene presumably functions in GPI anchoring at the GPI transfer step. The mRNA transcript is ubiquitously expressed in both fetal and adult tissues. The anchor attachment protein 1 contains an N-terminal signal sequence, 1 cAMP- and cGMP-dependent protein kinase phosphorylation site, 1 leucine zipper pattern, 2 potential N-glycosylation sites, and 8 putative transmembrane domains.
Uniprot IDO43292
Protein Accession #NP_003792
Nucleotide Accession #NM_003801
Protein Size (# AA)621
Molecular Weight67kDa
Protein InteractionsUBC; PIGT; PIGU; PRR13; PIGK; EIF3E; PIN1; GRIK5; PIGS;
  1. What is the species homology for "GPAA1 Antibody - C-terminal region : FITC (ARP46363_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "GPAA1 Antibody - C-terminal region : FITC (ARP46363_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "GPAA1 Antibody - C-terminal region : FITC (ARP46363_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "GPAA1 Antibody - C-terminal region : FITC (ARP46363_P050-FITC)"?

    This target may also be called "GAA1, hGAA1, GPIBD15" in publications.

  5. What is the shipping cost for "GPAA1 Antibody - C-terminal region : FITC (ARP46363_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "GPAA1 Antibody - C-terminal region : FITC (ARP46363_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "GPAA1 Antibody - C-terminal region : FITC (ARP46363_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "67kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "GPAA1 Antibody - C-terminal region : FITC (ARP46363_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "GPAA1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "GPAA1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "GPAA1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "GPAA1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "GPAA1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "GPAA1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:GPAA1 Antibody - C-terminal region : FITC (ARP46363_P050-FITC)
Your Rating
We found other products you might like!