Search Antibody, Protein, and ELISA Kit Solutions

GPAA1 Antibody - C-terminal region (ARP46363_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP46363_P050-FITC Conjugated

ARP46363_P050-HRP Conjugated

ARP46363_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Glycosylphosphatidylinositol anchor attachment protein 1 homolog (yeast)
NCBI Gene Id:
Protein Name:
Glycosylphosphatidylinositol anchor attachment 1 protein
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-373710 from Santa Cruz Biotechnology.
Description of Target:
Posttranslational glycosylphosphatidylinositol (GPI) anchor attachment serves as a general mechanism for linking proteins to the cell surface membrane. GPAA1 presumably functions in GPI anchoring at the GPI transfer step. The anchor attachment protein 1 contains an N-terminal signal sequence, 1 cAMP- and cGMP-dependent protein kinase phosphorylation site, 1 leucine zipper pattern, 2 potential N-glycosylation sites, and 8 putative transmembrane domains.Posttranslational glycosylphosphatidylinositol (GPI) anchor attachment serves as a general mechanism for linking proteins to the cell surface membrane. The protein encoded by this gene presumably functions in GPI anchoring at the GPI transfer step. The mRNA transcript is ubiquitously expressed in both fetal and adult tissues. The anchor attachment protein 1 contains an N-terminal signal sequence, 1 cAMP- and cGMP-dependent protein kinase phosphorylation site, 1 leucine zipper pattern, 2 potential N-glycosylation sites, and 8 putative transmembrane domains.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GPAA1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GPAA1.
The immunogen is a synthetic peptide directed towards the C terminal region of human GPAA1
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 100%
Complete computational species homology data:
Anti-GPAA1 (ARP46363_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LGSLFLWRELQEAPLSLAEGWQLFLAALAQGVLEHHTYGALLFPLLSLGL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-GPAA1 (ARP46363_P050) antibody is Catalog # AAP46363 (Previous Catalog # AAPP27149)
Printable datasheet for anti-GPAA1 (ARP46363_P050) antibody
Target Reference:
Vainauskas,S. (2005) J. Biol. Chem. 280 (16), 16402-16409

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...