GP2 Antibody - middle region (ARP44543_P050)

Catalog No: ARP44543_P050

Host: Rabbit
Target Name: GP2
Sample Type: HepG2
Antibody Dilution: 1.0ug/mlThere is BioGPS gene expression data showing that GP2 is expressed in HepG2

WB Suggested Anti-GP2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human heart

Host: Rabbit
Target Name: GP2
Sample Type: Human Fetal Muscle
Antibody Dilution: 1.0ug/ml

Host: Rabbit
Target: GP2
Positive control (+): Human Fetal Heart (HE)
Negative control (-): Human Brain (BR)
Antibody concentration: 1ug/ml

Anti-GP2 antibody IHC staining of human pancreas. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Horse, Pig
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GP2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 79%; Horse: 92%; Human: 100%; Mouse: 92%; Pig: 79%; Rat: 92%
• Peptide Sequence: Synthetic peptide located within the following region: SLQAALQPIVSSLNVSVDGNGEFIVRMALFQDQNYTNPYEGDAVELSVES
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-GP2 (ARP44543_P050) antibody is Catalog # AAP44543 (Previous Catalog # AAPP12059)
• Sample Type Confirmation:

  There is BioGPS gene expression data showing that GP2 is expressed in HepG2

• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Reference: Tamiya,G., (2005) Hum. Mol. Genet. 14 (16), 2305-2321

Target Info

• Gene Symbol: GP2
• Gene Full Name: Glycoprotein 2 (zymogen granule membrane)
• Alias Symbols: ZAP75
• NCBI Gene Id: 2813
• Protein Name: Pancreatic secretory granule membrane major glycoprotein GP2
• Description of Target: GP2 is component of pancreatic secretory (zymogen) granule. The exact function of GP2 remains unknown.
• Uniprot ID: P55259
• Protein Accession #: NP_001007242
• Nucleotide Accession #: NM_001007241
• Protein Size (# AA): 390
• Molecular Weight: 59 kDa
• Protein Interactions: TSSK3; SOX30; GP2; ANXA4; AMY2A;