- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
| Datasheets/Manuals | Printable datasheet for GP1BA Antibody (OAAF08094) |
|---|
| Predicted Species Reactivity | Human|Mouse|Rat |
|---|---|
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry-Paraffin|Western blot |
| Reconstitution and Storage | -20°C |
| Immunogen | The antiserum was produced against synthesized peptide derived from the Internal region of human GP1BA. |
| Purification | The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using peptide. |
| Peptide Sequence | Synthetic peptide located within the following region: PVYKYPGKGCPTLGDEGDTDLYDYYPEEDTEGDKVRATRTVVKFPTKAHT |
| Concentration | 1mg/ml |
| Specificity | GP1BA Antibody detects endogenous levels of GP1BA protein. |
| Formulation | Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. |
| Application Info | WB: 1:500~1:1000 ELISA: 1:10000 |
| Gene Symbol | GP1BA |
|---|---|
| Gene Full Name | glycoprotein Ib platelet subunit alpha |
| Alias Symbols | antigen CD42b-alpha;BDPLT1;BDPLT3;BSS;CD42B;CD42b-alpha;DBPLT3;glycoprotein Ib (platelet), alpha polypeptide;glycoprotein Ib platelet alpha subunit;GP1B;GP-Ib alpha;GPIbA;GPIbalpha;mutant platelet membrane glycoprotein Ib-alpha;platelet glycoprotein Ib alpha chain;platelet membrane glycoprotein 1b-alpha subunit;platelet membrane glycoprotein Ib-alpha;VWDP. |
| NCBI Gene Id | 2811 |
| Protein Name | Platelet glycoprotein Ib alpha chain |
| Description of Target | GP-Ib, a surface membrane protein of platelets, participates in the formation of platelet plugs by binding to the A1 domain of vWF, which is already bound to the subendothelium. |
| Uniprot ID | P07359 |
| Molecular Weight | 71-145 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "GP1BA Antibody (OAAF08094)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human|Mouse|Rat".
-
How long will it take to receive "GP1BA Antibody (OAAF08094)"?
This item is available "Domestic: within 1-2 week delivery | International: 1-2 weeks".
-
What buffer format is "GP1BA Antibody (OAAF08094)" provided in?
This item is provided in "".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "GP1BA Antibody (OAAF08094)"?
This target may also be called "antigen CD42b-alpha;BDPLT1;BDPLT3;BSS;CD42B;CD42b-alpha;DBPLT3;glycoprotein Ib (platelet), alpha polypeptide;glycoprotein Ib platelet alpha subunit;GP1B;GP-Ib alpha;GPIbA;GPIbalpha;mutant platelet membrane glycoprotein Ib-alpha;platelet glycoprotein Ib alpha chain;platelet membrane glycoprotein 1b-alpha subunit;platelet membrane glycoprotein Ib-alpha;VWDP." in publications.
-
What is the shipping cost for "GP1BA Antibody (OAAF08094)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "GP1BA Antibody (OAAF08094)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "GP1BA Antibody (OAAF08094)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "71-145 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "GP1BA Antibody (OAAF08094)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "GP1BA"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "GP1BA"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "GP1BA"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "GP1BA"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "GP1BA"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "GP1BA"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.