- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
GP1BA Antibody - C-terminal region : Biotin (ARP51319_P050-Biotin)
Datasheets/Manuals | Printable datasheet for anti-GP1BA (ARP51319_P050-Biotin) antibody |
---|
Predicted Species Reactivity | Human, Mouse, Rat, Dog, Horse, Rabbit |
---|---|
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
Clonality | Polyclonal |
Host | Rabbit |
Conjugation | Biotin |
Application | WB |
Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human GP1BA |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Dog: 77%; Horse: 92%; Human: 100%; Mouse: 86%; Rabbit: 79%; Rat: 86% |
Peptide Sequence | Synthetic peptide located within the following region: RGSLPTFRSSLFLWVRPNGRVGPLVAGRRPSALSQGRGQDLLSTVSIRYS |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-GP1BA (ARP51319_P050-Biotin) antibody is Catalog # AAP51319 (Previous Catalog # AAPS23408) |
Reference | Maguire,J.M., (2008) Stroke 39 (6), 1710-1716 |
Gene Symbol | GP1BA |
---|---|
Gene Full Name | Glycoprotein Ib (platelet), alpha polypeptide |
Alias Symbols | BSS, GP1B, VWDP, CD42B, GPIbA, BDPLT1, BDPLT3, DBPLT3, GPIbalpha, CD42b-alpha |
NCBI Gene Id | 2811 |
Protein Name | Platelet glycoprotein Ib alpha EMBL BAJ15421.1 |
Description of Target | Glycoprotein Ib (GP Ib) is a platelet surface membrane glycoprotein composed of a heterodimer, an alpha chain and a beta chain, that are linked by disulfide bonds. The Gp Ib functions as a receptor for von Willebrand factor (VWF). The complete receptor complex includes noncovalent association of the alpha and beta subunits with platelet glycoprotein IX and platelet glycoprotein V. The binding of the GP Ib-IX-V complex to VWF facilitates initial platelet adhesion to vascular subendothelium after vascular injury, and also initiates signaling events within the platelet that lead to enhanced platelet activation, thrombosis, and hemostasis. GP1BA is the alpha subunit.Glycoprotein Ib (GP Ib) is a platelet surface membrane glycoprotein composed of a heterodimer, an alpha chain and a beta chain, that are linked by disulfide bonds. The Gp Ib functions as a receptor for von Willebrand factor (VWF). The complete receptor complex includes noncovalent association of the alpha and beta subunits with platelet glycoprotein IX and platelet glycoprotein V. The binding of the GP Ib-IX-V complex to VWF facilitates initial platelet adhesion to vascular subendothelium after vascular injury, and also initiates signaling events within the platelet that lead to enhanced platelet activation, thrombosis, and hemostasis. This gene encodes the alpha subunit. Several polymorphisms and mutations have been described in this gene, some of which are the cause of Bernard-Soulier syndromes and platelet-type von Willebrand disease. Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Uniprot ID | A5CKE2 |
Protein Accession # | NP_000164 |
Nucleotide Accession # | NM_000173 |
Protein Size (# AA) | 639 |
Molecular Weight | 68kDa |
Protein Interactions | DDIT3; OSGEP; TPST1; FLNB; YWHAZ; FLNA; F12; GP1BA; KNG1; VWF; F2; SELP; GP9; GP5; ITGAM; CTSG; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "GP1BA Antibody - C-terminal region : Biotin (ARP51319_P050-Biotin)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Dog, Horse, Rabbit".
-
How long will it take to receive "GP1BA Antibody - C-terminal region : Biotin (ARP51319_P050-Biotin)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "GP1BA Antibody - C-terminal region : Biotin (ARP51319_P050-Biotin)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "GP1BA Antibody - C-terminal region : Biotin (ARP51319_P050-Biotin)"?
This target may also be called "BSS, GP1B, VWDP, CD42B, GPIbA, BDPLT1, BDPLT3, DBPLT3, GPIbalpha, CD42b-alpha" in publications.
-
What is the shipping cost for "GP1BA Antibody - C-terminal region : Biotin (ARP51319_P050-Biotin)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "GP1BA Antibody - C-terminal region : Biotin (ARP51319_P050-Biotin)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "GP1BA Antibody - C-terminal region : Biotin (ARP51319_P050-Biotin)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "68kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "GP1BA Antibody - C-terminal region : Biotin (ARP51319_P050-Biotin)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "GP1BA"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "GP1BA"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "GP1BA"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "GP1BA"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "GP1BA"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "GP1BA"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.