GP1BA Antibody - C-terminal region : Biotin (ARP51319_P050-Biotin)

Catalog No: ARP51319_P050-Biotin

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Dog, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: Biotin
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GP1BA
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Dog: 77%; Horse: 92%; Human: 100%; Mouse: 86%; Rabbit: 79%; Rat: 86%
• Peptide Sequence: Synthetic peptide located within the following region: RGSLPTFRSSLFLWVRPNGRVGPLVAGRRPSALSQGRGQDLLSTVSIRYS
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-GP1BA (ARP51319_P050-Biotin) antibody is Catalog # AAP51319 (Previous Catalog # AAPS23408)
• Reference: Maguire,J.M., (2008) Stroke 39 (6), 1710-1716

Target Info

• Gene Symbol: GP1BA
• Gene Full Name: Glycoprotein Ib (platelet), alpha polypeptide
• Alias Symbols: BSS, GP1B, VWDP, CD42B, GPIbA, BDPLT1, BDPLT3, DBPLT3, GPIbalpha, CD42b-alpha
• NCBI Gene Id: 2811
• Protein Name: Platelet glycoprotein Ib alpha EMBL BAJ15421.1
• Description of Target: Glycoprotein Ib (GP Ib) is a platelet surface membrane glycoprotein composed of a heterodimer, an alpha chain and a beta chain, that are linked by disulfide bonds. The Gp Ib functions as a receptor for von Willebrand factor (VWF). The complete receptor complex includes noncovalent association of the alpha and beta subunits with platelet glycoprotein IX and platelet glycoprotein V. The binding of the GP Ib-IX-V complex to VWF facilitates initial platelet adhesion to vascular subendothelium after vascular injury, and also initiates signaling events within the platelet that lead to enhanced platelet activation, thrombosis, and hemostasis. GP1BA is the alpha subunit.Glycoprotein Ib (GP Ib) is a platelet surface membrane glycoprotein composed of a heterodimer, an alpha chain and a beta chain, that are linked by disulfide bonds. The Gp Ib functions as a receptor for von Willebrand factor (VWF). The complete receptor complex includes noncovalent association of the alpha and beta subunits with platelet glycoprotein IX and platelet glycoprotein V. The binding of the GP Ib-IX-V complex to VWF facilitates initial platelet adhesion to vascular subendothelium after vascular injury, and also initiates signaling events within the platelet that lead to enhanced platelet activation, thrombosis, and hemostasis. This gene encodes the alpha subunit. Several polymorphisms and mutations have been described in this gene, some of which are the cause of Bernard-Soulier syndromes and platelet-type von Willebrand disease. Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: A5CKE2
• Protein Accession #: NP_000164
• Nucleotide Accession #: NM_000173
• Protein Size (# AA): 639
• Molecular Weight: 68kDa
• Protein Interactions: DDIT3; OSGEP; TPST1; FLNB; YWHAZ; FLNA; F12; GP1BA; KNG1; VWF; F2; SELP; GP9; GP5; ITGAM; CTSG;