Size:100 ul
$319.00
In stock
SKU
ARP51319_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP51319_P050-FITC Conjugated

ARP51319_P050-HRP Conjugated

ARP51319_P050-Biotin Conjugated

More Information
Tested Species Reactivity Human
Predicted Species Reactivity Dog, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Conjugation Unconjugated
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-114145 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human GP1BA
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Dog: 77%; Horse: 92%; Human: 100%; Mouse: 86%; Rabbit: 79%; Rat: 86%
Complete computational species homology data Anti-GP1BA (ARP51319_P050)
Peptide Sequence Synthetic peptide located within the following region: RGSLPTFRSSLFLWVRPNGRVGPLVAGRRPSALSQGRGQDLLSTVSIRYS
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-GP1BA (ARP51319_P050) antibody is Catalog # AAP51319 (Previous Catalog # AAPS23408)
Datasheets/Manuals Printable datasheet for anti-GP1BA (ARP51319_P050) antibody
Target Reference Maguire,J.M., (2008) Stroke 39 (6), 1710-1716
Publications

Cooper, S; Lloyd, S; Koch, A; Lin, X; Dobbs, K; Theisen, T; Zuberbuehler, M; Bernhardt, K; Gyorfi, M; Tenpas, T; Hying, S; Mortimer, S; Lamont, C; Lehmann, M; Neeves, K; Temperature effects on the activity, shape, and storage of platelets from 13-lined ground squirrels. , (2017). WB, Dog, Horse, Human, Mouse, Rabbit, Rat 28332020

Gene Symbol GP1BA
Official Gene Full Name Glycoprotein Ib (platelet), alpha polypeptide
Alias Symbols BSS, CD42B, CD42b-alpha, GP1B, MGC34595, VWDP, GPIbA, BDPLT1, BDPLT3, DBPLT3
NCBI Gene Id 2811
Protein Name Platelet glycoprotein Ib alpha EMBL BAJ15421.1
Description of Target Glycoprotein Ib (GP Ib) is a platelet surface membrane glycoprotein composed of a heterodimer, an alpha chain and a beta chain, that are linked by disulfide bonds. The Gp Ib functions as a receptor for von Willebrand factor (VWF). The complete receptor complex includes noncovalent association of the alpha and beta subunits with platelet glycoprotein IX and platelet glycoprotein V. The binding of the GP Ib-IX-V complex to VWF facilitates initial platelet adhesion to vascular subendothelium after vascular injury, and also initiates signaling events within the platelet that lead to enhanced platelet activation, thrombosis, and hemostasis. GP1BA is the alpha subunit.Glycoprotein Ib (GP Ib) is a platelet surface membrane glycoprotein composed of a heterodimer, an alpha chain and a beta chain, that are linked by disulfide bonds. The Gp Ib functions as a receptor for von Willebrand factor (VWF). The complete receptor complex includes noncovalent association of the alpha and beta subunits with platelet glycoprotein IX and platelet glycoprotein V. The binding of the GP Ib-IX-V complex to VWF facilitates initial platelet adhesion to vascular subendothelium after vascular injury, and also initiates signaling events within the platelet that lead to enhanced platelet activation, thrombosis, and hemostasis. This gene encodes the alpha subunit. Several polymorphisms and mutations have been described in this gene, some of which are the cause of Bernard-Soulier syndromes and platelet-type von Willebrand disease. Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id P07359
Protein Accession # NP_000164
Nucleotide Accession # NM_000173
Protein Size (# AA) 639
Molecular Weight 68kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express GP1BA.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express GP1BA.
Protein Interactions DDIT3; OSGEP; TPST1; FLNB; YWHAZ; FLNA; F12; GP1BA; KNG1; VWF; F2; SELP; GP9; GP5; ITGAM; CTSG;
Write Your Own Review
You're reviewing:GP1BA Antibody - C-terminal region (ARP51319_P050)
Your Rating