Search Antibody, Protein, and ELISA Kit Solutions

GP1BA Antibody - C-terminal region (ARP51319_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP51319_P050-FITC Conjugated

ARP51319_P050-HRP Conjugated

ARP51319_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Glycoprotein Ib (platelet), alpha polypeptide
NCBI Gene Id:
Protein Name:
Platelet glycoprotein Ib alpha EMBL BAJ15421.1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
BSS, CD42B, CD42b-alpha, GP1B, MGC34595, VWDP, GPIbA, BDPLT1, BDPLT3, DBPLT3
Replacement Item:
This antibody may replace item sc-114145 from Santa Cruz Biotechnology.
Description of Target:
Glycoprotein Ib (GP Ib) is a platelet surface membrane glycoprotein composed of a heterodimer, an alpha chain and a beta chain, that are linked by disulfide bonds. The Gp Ib functions as a receptor for von Willebrand factor (VWF). The complete receptor complex includes noncovalent association of the alpha and beta subunits with platelet glycoprotein IX and platelet glycoprotein V. The binding of the GP Ib-IX-V complex to VWF facilitates initial platelet adhesion to vascular subendothelium after vascular injury, and also initiates signaling events within the platelet that lead to enhanced platelet activation, thrombosis, and hemostasis. GP1BA is the alpha subunit.Glycoprotein Ib (GP Ib) is a platelet surface membrane glycoprotein composed of a heterodimer, an alpha chain and a beta chain, that are linked by disulfide bonds. The Gp Ib functions as a receptor for von Willebrand factor (VWF). The complete receptor complex includes noncovalent association of the alpha and beta subunits with platelet glycoprotein IX and platelet glycoprotein V. The binding of the GP Ib-IX-V complex to VWF facilitates initial platelet adhesion to vascular subendothelium after vascular injury, and also initiates signaling events within the platelet that lead to enhanced platelet activation, thrombosis, and hemostasis. This gene encodes the alpha subunit. Several polymorphisms and mutations have been described in this gene, some of which are the cause of Bernard-Soulier syndromes and platelet-type von Willebrand disease. Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GP1BA.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GP1BA.
The immunogen is a synthetic peptide directed towards the C terminal region of human GP1BA
Predicted Species Reactivity:
Dog, Horse, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Dog: 77%; Horse: 92%; Human: 100%; Mouse: 86%; Rabbit: 79%; Rat: 86%
Complete computational species homology data:
Anti-GP1BA (ARP51319_P050)
Peptide Sequence:
Synthetic peptide located within the following region: RGSLPTFRSSLFLWVRPNGRVGPLVAGRRPSALSQGRGQDLLSTVSIRYS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-GP1BA (ARP51319_P050) antibody is Catalog # AAP51319 (Previous Catalog # AAPS23408)
Printable datasheet for anti-GP1BA (ARP51319_P050) antibody
Target Reference:
Maguire,J.M., (2008) Stroke 39 (6), 1710-1716

Cooper, S; Lloyd, S; Koch, A; Lin, X; Dobbs, K; Theisen, T; Zuberbuehler, M; Bernhardt, K; Gyorfi, M; Tenpas, T; Hying, S; Mortimer, S; Lamont, C; Lehmann, M; Neeves, K; Temperature effects on the activity, shape, and storage of platelets from 13-lined ground squirrels. , (2017). WB, Dog, Horse, Human, Mouse, Rabbit, Rat 28332020

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...