Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP43517_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP43517_P050-FITC Conjugated

ARP43517_P050-HRP Conjugated

ARP43517_P050-Biotin Conjugated

GOT2 Antibody - N-terminal region (ARP43517_P050)

Catalog#: ARP43517_P050
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human GOT2
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 100%
Complete computational species homology data Anti-GOT2 (ARP43517_P050)
Peptide Sequence Synthetic peptide located within the following region: VEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEA
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-GOT2 (ARP43517_P050) antibody is Catalog # AAPY01352
Datasheets/Manuals Printable datasheet for anti-GOT2 (ARP43517_P050) antibody
Target Reference Tsai,S.J., Psychiatr. Genet. 17 (5), 314 (2007)
Publications

Povlsen, J. A. et al. Protection against myocardial ischemia-reperfusion injury at onset of type 2 diabetes in Zucker diabetic fatty rats is associated with altered glucose oxidation. PLoS One 8, e64093 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 23704975

Gene Symbol GOT2
Official Gene Full Name Glutamic-oxaloacetic transaminase 2, mitochondrial (aspartate aminotransferase 2)
Alias Symbols FLJ40994, kat4, kativ, mitaat, KAT4, KATIV, mitAAT
NCBI Gene Id 2806
Protein Name Aspartate aminotransferase, mitochondrial
Description of Target Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology.Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id P00505
Protein Accession # NP_002071
Nucleotide Accession # NM_002080
Protein Size (# AA) 430
Molecular Weight 45kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express GOT2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express GOT2.
Protein Interactions FUS; UBC; NEDD8; MDM2; CDK2; CCL21; GLRX; GAPDH; APCS; AI837181; HDAC5; PSMD4; THOC7; ZDHHC6; GLUD1; HSPA8; PC; MDH2; CTNNBIP1; MPG;
  1. What is the species homology for "GOT2 Antibody - N-terminal region (ARP43517_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish".

  2. How long will it take to receive "GOT2 Antibody - N-terminal region (ARP43517_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "GOT2 Antibody - N-terminal region (ARP43517_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "GOT2 Antibody - N-terminal region (ARP43517_P050)"?

    This target may also be called "FLJ40994, kat4, kativ, mitaat, KAT4, KATIV, mitAAT" in publications.

  5. What is the shipping cost for "GOT2 Antibody - N-terminal region (ARP43517_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "GOT2 Antibody - N-terminal region (ARP43517_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "GOT2 Antibody - N-terminal region (ARP43517_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "45kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "GOT2 Antibody - N-terminal region (ARP43517_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "GOT2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "GOT2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "GOT2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "GOT2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "GOT2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "GOT2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:GOT2 Antibody - N-terminal region (ARP43517_P050)
Your Rating
We found other products you might like!