SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP43518_T100
Price: $0.00
SKU
ARP43518_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-GOT2 (ARP43518_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human GOT2
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: AILNTPDLRKQWLQEVKVMADRIIGMRTQLVSNLKKEGSTHNWQHITDQI
Concentration1.0 mg/ml
Blocking PeptideFor anti-GOT2 (ARP43518_T100) antibody is Catalog # AAP43518 (Previous Catalog # AAPS15711)
Sample Type Confirmation

GOT2 is supported by BioGPS gene expression data to be expressed in HepG2

ReferenceSuzuki,Y., Gene 200 (1-2), 149-156 (1997)
Publications

Vitamin C and E Treatment Blocks Changes in Kynurenine Metabolism Triggered by Three Weeks of Sprint Interval Training in Recreationally Active Elderly Humans. Antioxidants (Basel). 10 (2021). 34573075

Description
Gene SymbolGOT2
Gene Full NameGlutamic-oxaloacetic transaminase 2, mitochondrial (aspartate aminotransferase 2)
Alias SymbolsKAT4, DEE82, KATIV, KYAT4, mitAAT
NCBI Gene Id2806
Protein NameAspartate aminotransferase, mitochondrial
Description of TargetGlutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology.Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology.
Uniprot IDP00505
Protein Accession #NP_002071
Nucleotide Accession #NM_002080
Protein Size (# AA)430
Molecular Weight45kDa
Protein InteractionsFUS; UBC; NEDD8; MDM2; CDK2; CCL21; GLRX; GAPDH; APCS; AI837181; HDAC5; PSMD4; THOC7; ZDHHC6; GLUD1; HSPA8; PC; MDH2; CTNNBIP1; MPG;
  1. What is the species homology for "GOT2 Antibody - C-terminal region (ARP43518_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "GOT2 Antibody - C-terminal region (ARP43518_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "GOT2 Antibody - C-terminal region (ARP43518_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "GOT2 Antibody - C-terminal region (ARP43518_T100)"?

    This target may also be called "KAT4, DEE82, KATIV, KYAT4, mitAAT" in publications.

  5. What is the shipping cost for "GOT2 Antibody - C-terminal region (ARP43518_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "GOT2 Antibody - C-terminal region (ARP43518_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "GOT2 Antibody - C-terminal region (ARP43518_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "45kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "GOT2 Antibody - C-terminal region (ARP43518_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "GOT2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "GOT2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "GOT2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "GOT2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "GOT2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "GOT2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:GOT2 Antibody - C-terminal region (ARP43518_T100)
Your Rating
We found other products you might like!