Catalog No: ARP56215_P050
Price: $0.00
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-GOPC (ARP56215_P050) antibody
Product Info
ReferenceWolde,M., (2007) J. Biol. Chem. 282 (11), 8099-8109
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human GOPC
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: RNDLKRPMQAPPGHDQDSLKKSQGVGPIRKVLLLKEDHEGLGISITGGKE
Concentration0.5 mg/ml
Blocking PeptideFor anti-GOPC (ARP56215_P050) antibody is Catalog # AAP56215 (Previous Catalog # AAPP38134)
Gene SymbolGOPC
Gene Full NameGolgi-associated PDZ and coiled-coil motif containing
Alias SymbolsCAL, FIG, PIST, GOPC1, dJ94G16.2
NCBI Gene Id57120
Protein NameGolgi-associated PDZ and coiled-coil motif-containing protein
Description of TargetGOPC plays a role in intracellular protein trafficking and degradation. GOPC may regulate CFTR chloride currents and acid-induced ACCN3 currents by modulating cell surface expression of both channels. GOPC may also regulate the intracellular trafficking of the ADR1B receptor. GOPC may play a role in autophagy. Overexpression of GOPC results in CFTR intracellular retention and degradation in the lysosomes.PIST is a PDZ domain-containing Golgi protein. PDZ domains contain approximately 90 amino acids and bind the extreme C terminus of proteins in a sequence-specific manner.[supplied by OMIM].
Uniprot IDQ9HD26
Protein Accession #NP_001017408
Nucleotide Accession #NM_001017408
Protein Size (# AA)454
Molecular Weight50kDa
Protein InteractionsBATF; SSNA1; VTN; MYLK; HCK; FOSL2; DPYD; RPL13AP17; C17orf67; ZSCAN1; LCLAT1; FAM9B; ZBTB49; ZNF564; SPATA8; RNF183; MORN4; MYOCD; MUM1; ZNF587; SLC25A18; CCDC102B; AKIRIN1; MRPL1; SEMA4G; RNF220; FAM90A1; PID1; ZNF581; CERCAM; RHOQ; PARK7; STARD3; HSF1;
  1. What is the species homology for "GOPC Antibody - middle region (ARP56215_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "GOPC Antibody - middle region (ARP56215_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "GOPC Antibody - middle region (ARP56215_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "GOPC Antibody - middle region (ARP56215_P050)"?

    This target may also be called "CAL, FIG, PIST, GOPC1, dJ94G16.2" in publications.

  5. What is the shipping cost for "GOPC Antibody - middle region (ARP56215_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "GOPC Antibody - middle region (ARP56215_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "GOPC Antibody - middle region (ARP56215_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "50kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "GOPC Antibody - middle region (ARP56215_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "GOPC"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "GOPC"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "GOPC"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "GOPC"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "GOPC"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "GOPC"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:GOPC Antibody - middle region (ARP56215_P050)
Your Rating
We found other products you might like!