Search Antibody, Protein, and ELISA Kit Solutions

GON7 Antibody - C-terminal region (ARP69018_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP69018_P050-FITC Conjugated

ARP69018_P050-HRP Conjugated

ARP69018_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
Official Gene Full Name:
GON7, KEOPS complex subunit
NCBI Gene Id:
Protein Name:
EKC/KEOPS complex subunit GON7
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
PNAS-127, C14orf142
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GON7.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GON7.
The immunogen is a synthetic peptide directed towards the C-terminal region of Human C14orf142
Predicted Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Pig, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 86%; Horse: 86%; Human: 100%; Mouse: 91%; Pig: 79%; Rat: 91%
Peptide Sequence:
Synthetic peptide located within the following region: LVQGEVQHRVAAAPDEDLDGDDEDDAEDENNIDNRTNFDGPSAKRPKTPS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-GON7 (ARP69018_P050) antibody is Catalog # AAP69018
Printable datasheet for anti-GON7 (ARP69018_P050) antibody

Wan, LC; Maisonneuve, P; Szilard, RK; Lambert, JP; Ng, TF; Manczyk, N; Huang, H; Laister, R; Caudy, AA; Gingras, AC; Durocher, D; Sicheri, F; Proteomic analysis of the human KEOPS complex identifies C14ORF142 as a core subunit homologous to yeast Gon7. 45, 805-817 (2017). WB, Cow, Dog, Horse, Human, Mouse, Pig, Rat 27903914

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...