Search Antibody, Protein, and ELISA Kit Solutions

GNL3L antibody - N-terminal region (ARP58798_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP58798_P050-FITC Conjugated

ARP58798_P050-HRP Conjugated

ARP58798_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Guanine nucleotide binding protein-like 3 (nucleolar)-like
Protein Name:
Guanine nucleotide-binding protein-like 3-like protein
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
FLJ10613, RP11-353K22.1
Replacement Item:
This antibody may replace item sc-145654, HPA036314
Description of Target:
GNL3L is required for normal processing of ribosomal pre-rRNA and cell proliferation.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GNL3L.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GNL3L.
The immunogen is a synthetic peptide directed towards the N terminal region of human GNL3L
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 86%; Human: 100%; Mouse: 86%; Pig: 86%; Rabbit: 86%; Rat: 86%
Complete computational species homology data:
Anti-GNL3L (ARP58798_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MMKLRHKNKKPGEGSKGHKKISWPYPQPAKQNGKKATSKVPSAPHFVHPN
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-GNL3L (ARP58798_P050) antibody is Catalog # AAP58798 (Previous Catalog # AAPP38616)
Printable datasheet for anti-GNL3L (ARP58798_P050) antibody
Target Reference:
Rao,M.R., (2006) J. Mol. Biol. 364 (4), 637-654

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...