Aviva Systems Biology office will be closed for Christmas and New Year Holiday - December 24-25, 2018 and January 1, 2019.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

GNL3L antibody - N-terminal region (ARP58798_P050)

100 ul
$289.00
In Stock

Conjugation Options

ARP58798_P050-FITC Conjugated

ARP58798_P050-HRP Conjugated

ARP58798_P050-Biotin Conjugated

Gene Symbol:
GNL3L
NCBI Gene Id:
54552
Official Gene Full Name:
Guanine nucleotide binding protein-like 3 (nucleolar)-like
Protein Name:
Guanine nucleotide-binding protein-like 3-like protein
Swissprot Id:
Q9NVN8
Protein Accession #:
NP_061940
Nucleotide Accession #:
NM_019067
Alias Symbols:
FLJ10613, RP11-353K22.1
Replacement Item:
This antibody may replace item sc-145654, HPA036314
Description of Target:
GNL3L is required for normal processing of ribosomal pre-rRNA and cell proliferation.
Protein Size (# AA):
582
Molecular Weight:
65kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GNL3L.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GNL3L.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human GNL3L
Species Reactivity:
Cow, Dog, Human, Mouse, Pig, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 86%; Human: 100%; Mouse: 86%; Pig: 86%; Rabbit: 86%; Rat: 86%
Complete computational species homology data:
Anti-GNL3L (ARP58798_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MMKLRHKNKKPGEGSKGHKKISWPYPQPAKQNGKKATSKVPSAPHFVHPN
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
LZTS2; ROPN1; ALAS1; ADRB2; UBC; UBD; SLC2A4; ELAVL1; TERT; TERF1; TP53; MDM2; LDOC1;
Blocking Peptide:
For anti-GNL3L (ARP58798_P050) antibody is Catalog # AAP58798 (Previous Catalog # AAPP38616)
Datasheets/Manuals:
Printable datasheet for anti-GNL3L (ARP58798_P050) antibody
Target Reference:
Rao,M.R., (2006) J. Mol. Biol. 364 (4), 637-654

Tell us what you think about this item!

Write A Review
    Please, wait...