Search Antibody, Protein, and ELISA Kit Solutions

GNL3 Antibody - C-terminal region (ARP88590_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
GNL3
Official Gene Full Name:
guanine nucleotide binding protein-like 3 (nucleolar)
NCBI Gene Id:
26354
Protein Name:
guanine nucleotide-binding protein-like 3
Swissprot Id:
Q9BVP2
Protein Accession #:
NP_055181.3
Nucleotide Accession #:
NM_014366.4
Alias Symbols:
NS, E2IG3, NNP47, C77032
Description of Target:
The protein encoded by this gene may interact with p53 and may be involved in tumorigenesis. The encoded protein also appears to be important for stem cell proliferation. This protein is found in both the nucleus and nucleolus. Three transcript variants encoding two different isoforms have been found for this gene.
Protein Size (# AA):
549
Molecular Weight:
62 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GNL3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GNL3.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human GNL3
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: LFQSSGLTNGIIEEKDIHEELPKRKERKQEEREDDKDSDQETVDEEVDEN
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-GNL3 (ARP88590_P050) antibody is Catalog # AAP88590
Datasheets/Manuals:
Printable datasheet for anti-GNL3 (ARP88590_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...