Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP74544_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

GNB1L Antibody - N-terminal region (ARP74544_P050)

Catalog#: ARP74544_P050
Domestic: within 24 hours delivery | International: 3-5 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-133630 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human GNB1L
Purification Affinity purified
Peptide Sequence Synthetic peptide located within the following region: MTAPCPPPPPDPQFVLRGTQSPVHALHFCEGAQAQGRPLLFSGSQSGLVH
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-GNB1L (ARP74544_P050) antibody is Catalog # AAP74544
Datasheets/Manuals Printable datasheet for anti-GNB1L (ARP74544_P050) antibody
Gene Symbol GNB1L
Official Gene Full Name guanine nucleotide binding protein (G protein), beta polypeptide 1-like
Alias Symbols GY2, FKSG1, WDR14, WDVCF, DGCRK3,
NCBI Gene Id 54584
Protein Name guanine nucleotide-binding protein subunit beta-like protein 1
Description of Target This gene encodes a G-protein beta-subunit-like polypeptide which is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 6 WD repeats and is highly expressed in the heart. The gene maps to the region on chromosome 22q11, which is deleted in DiGeorge syndrome, trisomic in derivative 22 syndrome and tetrasomic in cat-eye syndrome. Therefore, this gene may contribute to the etiology of those disorders. Transcripts from this gene share exons with some transcripts from the C22orf29 gene.
Swissprot Id Q9BYB4
Protein Accession # NP_443730.1
Nucleotide Accession # NM_053004.2
Protein Size (# AA) 327
Molecular Weight 35 kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express GNB1L.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express GNB1L.
  1. What is the species homology for "GNB1L Antibody - N-terminal region (ARP74544_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "GNB1L Antibody - N-terminal region (ARP74544_P050)"?

    This item is available "Domestic: within 24 hours delivery | International: 3-5 days".

  3. What buffer format is "GNB1L Antibody - N-terminal region (ARP74544_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "GNB1L Antibody - N-terminal region (ARP74544_P050)"?

    This target may also be called "GY2, FKSG1, WDR14, WDVCF, DGCRK3, " in publications.

  5. What is the shipping cost for "GNB1L Antibody - N-terminal region (ARP74544_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "GNB1L Antibody - N-terminal region (ARP74544_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "GNB1L Antibody - N-terminal region (ARP74544_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "35 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "GNB1L Antibody - N-terminal region (ARP74544_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "GNB1L"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "GNB1L"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "GNB1L"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "GNB1L"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "GNB1L"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "GNB1L"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:GNB1L Antibody - N-terminal region (ARP74544_P050)
Your Rating
We found other products you might like!