Search Antibody, Protein, and ELISA Kit Solutions

GNB1L Antibody - N-terminal region (ARP74544_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Human
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
GNB1L
Official Gene Full Name:
guanine nucleotide binding protein (G protein), beta polypeptide 1-like
NCBI Gene Id:
54584
Protein Name:
guanine nucleotide-binding protein subunit beta-like protein 1
Swissprot Id:
Q9BYB4
Protein Accession #:
NP_443730.1
Nucleotide Accession #:
NM_053004.2
Alias Symbols:
GY2, FKSG1, WDR14, WDVCF, DGCRK3,
Replacement Item:
This antibody may replace item sc-133630 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a G-protein beta-subunit-like polypeptide which is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 6 WD repeats and is highly expressed in the heart. The gene maps to the region on chromosome 22q11, which is deleted in DiGeorge syndrome, trisomic in derivative 22 syndrome and tetrasomic in cat-eye syndrome. Therefore, this gene may contribute to the etiology of those disorders. Transcripts from this gene share exons with some transcripts from the C22orf29 gene.
Protein Size (# AA):
327
Molecular Weight:
35 kDa
Purification:
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GNB1L.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GNB1L.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human GNB1L
Peptide Sequence:
Synthetic peptide located within the following region: MTAPCPPPPPDPQFVLRGTQSPVHALHFCEGAQAQGRPLLFSGSQSGLVH
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-GNB1L (ARP74544_P050) antibody is Catalog # AAP74544
Datasheets/Manuals:
Printable datasheet for anti-GNB1L (ARP74544_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...