SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP42693_P050-Biotin
Size:100ul
Price: $434.00
SKU
ARP42693_P050-Biotin
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

GNAS Antibody - N-terminal region : Biotin (ARP42693_P050-Biotin)

Datasheets/ManualsPrintable datasheet for anti-GNAS (ARP42693_P050-Biotin) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationBiotin
ApplicationIHC, WB
Additional InformationIHC Information: Thyroid, Human: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Information: Thyroid, Human: Formalin-Fixed, Paraffin-Embedded (FFPE)
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human GNAS
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: VYRATHRLLLLGAGESGKSTIVKQMRILHVNGFNGEGGEEDPQAARSNSD
Concentration0.5 mg/ml
Blocking PeptideFor anti-GNAS (ARP42693_P050-Biotin) antibody is Catalog # AAP42693 (Previous Catalog # AAPP11574)
Sample Type Confirmation

GNAS is strongly supported by BioGPS gene expression data to be expressed in MCF7

ReferenceBagchi,G., (2008) Cancer Res. 68 (9), 3225-3231
Publications

Masyuk, A. I. et al. Ciliary subcellular localization of TGR5 determines the cholangiocyte functional response to bile acid signaling. Am. J. Physiol. Gastrointest. Liver Physiol. 304, G1013-24 (2013). WB, IHC, Mouse, Pig, Human, Rat, Dog, Bovine, Horse, Guinea pig, Rabbit 23578785

Moreno-Smith, M. et al. Biologic effects of dopamine on tumor vasculature in ovarian carcinoma. Neoplasia 15, 502-10 (2013). WB, IHC, Mouse, Pig, Human, Rat, Dog, Bovine, Horse, Guinea pig, Rabbit 23633922

Gene SymbolGNAS
Gene Full NameGNAS complex locus
Alias SymbolsAHO, GSA, GSP, POH, GPSA, NESP, SCG6, SgVI, GNAS1, PITA3, C20orf45
NCBI Gene Id2778
Protein NameGuanine nucleotide-binding protein G(s) subunit alpha isoforms short
Description of TargetMutations in GNAS gene result in pseudohypoparathyroidism type 1a, pseudohypoparathyroidism type 1b, Albright hereditary osteodystrophy, pseudopseudohypoparathyroidism, McCune-Albright syndrome, progressive osseus heteroplasia, polyostotic fibrous dysplasia of bone, and some pituitary tumors. This locus has a highly complex imprinted expression pattern. It gives rise to maternally, paternally, and biallelically expressed transcripts that are derived from four alternative promoters and 5' exons. Some transcripts contains a differentially methylated region (DMR) at their 5' exons, and this DMR is commonly found in imprinted genes and correlates with transcript expression. An antisense transcript exists, and this antisense transcript and one of the transcripts are paternally expressed, produce noncoding RNAs, and may regulate imprinting in this region. In addition, one of the transcripts contains a second overlapping ORF, which encodes a structurally unrelated protein - Alex. Alternative splicing of downstream exons is also observed, which results in different forms of the stimulatory G-protein alpha subunit, a key element of the classical signal transduction pathway linking receptor-ligand interactions with the activation of adenylyl cyclase and a variety of cellular reponses. Multiple transcript variants have been found for this gene, but the full-length nature and/or biological validity of some variants have not been determined. Mutations in this gene result in pseudohypoparathyroidism type 1a, pseudohypoparathyroidism type 1b, Albright hereditary osteodystrophy, pseudopseudohypoparathyroidism, McCune-Albright syndrome, progressive osseus heteroplasia, polyostotic fibrous dysplasia of bone, and some pituitary tumors.
Uniprot IDP63092
Protein Accession #NP_000507
Nucleotide Accession #NM_000516
Protein Size (# AA)394
Molecular Weight46kDa
Protein InteractionsPANX1; AXIN1; UBC; FUS; OPTN; PTGIR; HLA-A; ADRB2; NUCB2; NUCB1; LAMTOR1; SLC25A12; GNAQ; GNA11; UBD; TBXA2R; GNB1; AVPR2; SUMO1; PCK1; Ric8b; GNG2; CALM1; Haus1; Trim69; Cbx1; RIC8A; TTC1; SNX13; ADCY5; CRHR1; PTGDR; TSHR; CAV3; HTR6; RGS2; ADCY6; VIPR1;
  1. What is the species homology for "GNAS Antibody - N-terminal region : Biotin (ARP42693_P050-Biotin)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "GNAS Antibody - N-terminal region : Biotin (ARP42693_P050-Biotin)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "GNAS Antibody - N-terminal region : Biotin (ARP42693_P050-Biotin)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "GNAS Antibody - N-terminal region : Biotin (ARP42693_P050-Biotin)"?

    This target may also be called "AHO, GSA, GSP, POH, GPSA, NESP, SCG6, SgVI, GNAS1, PITA3, C20orf45" in publications.

  5. What is the shipping cost for "GNAS Antibody - N-terminal region : Biotin (ARP42693_P050-Biotin)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "GNAS Antibody - N-terminal region : Biotin (ARP42693_P050-Biotin)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "GNAS Antibody - N-terminal region : Biotin (ARP42693_P050-Biotin)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "46kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "GNAS Antibody - N-terminal region : Biotin (ARP42693_P050-Biotin)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "GNAS"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "GNAS"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "GNAS"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "GNAS"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "GNAS"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "GNAS"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:GNAS Antibody - N-terminal region : Biotin (ARP42693_P050-Biotin)
Your Rating
We found other products you might like!