Size:100 ul
$249.00
In stock
SKU
ARP42694_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP42694_T100-FITC Conjugated

ARP42694_T100-HRP Conjugated

ARP42694_T100-Biotin Conjugated

GNAS Antibody - N-terminal region (ARP42694_T100)

Catalog#: ARP42694_T100
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human, Mouse
Predicted Species Reactivity Cow, Human, Mouse, Pig, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-135914 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human GNAS
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Complete computational species homology data Anti-GNAS (ARP42694_T100)
Peptide Sequence Synthetic peptide located within the following region: SGKSTIVKQMRILHVNGFNGDSEKATKVQDIKNNLKEAIETIVAAMSNLV
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-GNAS (ARP42694_T100) antibody is Catalog # AAP42694 (Previous Catalog # AAPP24925)
Datasheets/Manuals Printable datasheet for anti-GNAS (ARP42694_T100) antibody
Sample Type Confirmation

GNAS is strongly supported by BioGPS gene expression data to be expressed in MCF7

There is BioGPS gene expression data showing that GNAS is expressed in HepG2, Jurkat

Target Reference Linglart,A., (2006) Endocrinology 147 (5), 2253-2262
Gene Symbol GNAS
Official Gene Full Name GNAS complex locus
Alias Symbols RP4-543J19.4, AHO, C20orf45, GNAS1, GPSA, GSA, GSP, MGC33735, PHP1A, PHP1B, POH, dJ309F20.1.1, dJ806M20.3.3, NESP, PHP1C
NCBI Gene Id 2778
Protein Name GNAS complex locus EMBL AAH89157.2
Description of Target Mutations in GNAS gene result in pseudohypoparathyroidism type 1a, pseudohypoparathyroidism type 1b, Albright hereditary osteodystrophy, pseudopseudohypoparathyroidism, McCune-Albright syndrome, progressive osseus heteroplasia, polyostotic fibrous dysplasia of bone, and some pituitary tumors.This gene has a highly complex imprinted expression pattern. It encodes maternally, paternally, and biallelically expressed proteins which are derived from alternatively spliced transcripts with alternate 5' exons. Each of the upstream exons is within a differentially methylated region, commonly found in imprinted genes. However, the close proximity (14 kb) of two oppositely expressed promoter regions is unusual. In addition, one of the alternate 5' exons introduces a frameshift relative to the other transcripts, resulting in one isoform which is structurally unrelated to the others. An antisense transcript exists, and may regulate imprinting in this region. Mutations in this gene result in pseudohypoparathyroidism type 1a (PHP1a), which has an atypical autosomal dominant inheritance pattern requiring maternal transmission for full penetrance. There are RefSeqs representing four transcript variants of this gene. Other transcript variants including four additional exons have been described; however, their full length sequences have not been determined.
Swissprot Id Q5FWY2
Protein Accession # NP_536351
Nucleotide Accession # NM_080426
Protein Size (# AA) 380
Molecular Weight 42kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express GNAS.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express GNAS.
Protein Interactions PANX1; AXIN1; UBC; FUS; OPTN; PTGIR; HLA-A; ADRB2; NUCB2; NUCB1; LAMTOR1; SLC25A12; GNAQ; GNA11; UBD; TBXA2R; GNB1; AVPR2; SUMO1; PCK1; Ric8b; GNG2; CALM1; Haus1; Trim69; Cbx1; RIC8A; TTC1; SNX13; ADCY5; CRHR1; PTGDR; TSHR; CAV3; HTR6; RGS2; ADCY6; VIPR1;
Write Your Own Review
You're reviewing:GNAS Antibody - N-terminal region (ARP42694_T100)
Your Rating