Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

GNAS Antibody - N-terminal region (ARP42693_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP42693_P050-FITC Conjugated

ARP42693_P050-HRP Conjugated

ARP42693_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
GNAS complex locus
NCBI Gene Id:
Protein Name:
Guanine nucleotide-binding protein G(s) subunit alpha isoforms short
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
AHO, C20orf45, GNAS1, GPSA, GSA, GSP, MGC33735, PHP1A, PHP1B, POH, dJ309F20.1.1, dJ806M20.3.3, NESP, PHP1C
Replacement Item:
This antibody may replace item sc-135914 from Santa Cruz Biotechnology.
Description of Target:
Mutations in GNAS gene result in pseudohypoparathyroidism type 1a, pseudohypoparathyroidism type 1b, Albright hereditary osteodystrophy, pseudopseudohypoparathyroidism, McCune-Albright syndrome, progressive osseus heteroplasia, polyostotic fibrous dysplasia of bone, and some pituitary tumors. This locus has a highly complex imprinted expression pattern. It gives rise to maternally, paternally, and biallelically expressed transcripts that are derived from four alternative promoters and 5' exons. Some transcripts contains a differentially methylated region (DMR) at their 5' exons, and this DMR is commonly found in imprinted genes and correlates with transcript expression. An antisense transcript exists, and this antisense transcript and one of the transcripts are paternally expressed, produce noncoding RNAs, and may regulate imprinting in this region. In addition, one of the transcripts contains a second overlapping ORF, which encodes a structurally unrelated protein - Alex. Alternative splicing of downstream exons is also observed, which results in different forms of the stimulatory G-protein alpha subunit, a key element of the classical signal transduction pathway linking receptor-ligand interactions with the activation of adenylyl cyclase and a variety of cellular reponses. Multiple transcript variants have been found for this gene, but the full-length nature and/or biological validity of some variants have not been determined. Mutations in this gene result in pseudohypoparathyroidism type 1a, pseudohypoparathyroidism type 1b, Albright hereditary osteodystrophy, pseudopseudohypoparathyroidism, McCune-Albright syndrome, progressive osseus heteroplasia, polyostotic fibrous dysplasia of bone, and some pituitary tumors.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GNAS.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GNAS.
The immunogen is a synthetic peptide directed towards the N terminal region of human GNAS
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Complete computational species homology data:
Anti-GNAS (ARP42693_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VYRATHRLLLLGAGESGKSTIVKQMRILHVNGFNGEGGEEDPQAARSNSD
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-GNAS (ARP42693_P050) antibody is Catalog # AAP42693 (Previous Catalog # AAPP11574)
Printable datasheet for anti-GNAS (ARP42693_P050) antibody
Sample Type Confirmation:

GNAS is strongly supported by BioGPS gene expression data to be expressed in MCF7

Additional Information:
IHC Information: Thyroid, Human: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Information: Thyroid, Human: Formalin-Fixed, Paraffin-Embedded (FFPE)
Target Reference:
Bagchi,G., (2008) Cancer Res. 68 (9), 3225-3231

Masyuk, A. I. et al. Ciliary subcellular localization of TGR5 determines the cholangiocyte functional response to bile acid signaling. Am. J. Physiol. Gastrointest. Liver Physiol. 304, G1013-24 (2013). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 23578785

Moreno-Smith, M. et al. Biologic effects of dopamine on tumor vasculature in ovarian carcinoma. Neoplasia 15, 502-10 (2013). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 23633922

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...