GNAS Antibody - N-terminal region (ARP42693_P050)

Catalog#: ARP42693_P050

• Size: 100 ul

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Additional Information: IHC Information: Thyroid, Human: Formalin-Fixed, Paraffin-Embedded (FFPE)
  IHC Information: Thyroid, Human: Formalin-Fixed, Paraffin-Embedded (FFPE)
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Replacement Item: This antibody may replace item sc-135914 from Santa Cruz Biotechnology.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GNAS
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: VYRATHRLLLLGAGESGKSTIVKQMRILHVNGFNGEGGEEDPQAARSNSD
• Concentration: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
• Blocking Peptide: For anti-GNAS (ARP42693_P050) antibody is Catalog # AAP42693 (Previous Catalog # AAPP11574)
• Sample Type Confirmation:

  GNAS is strongly supported by BioGPS gene expression data to be expressed in MCF7

• Target Reference: Bagchi,G., (2008) Cancer Res. 68 (9), 3225-3231
• Publications:

  Masyuk, A. I. et al. Ciliary subcellular localization of TGR5 determines the cholangiocyte functional response to bile acid signaling. Am. J. Physiol. Gastrointest. Liver Physiol. 304, G1013-24 (2013). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 23578785

  Moreno-Smith, M. et al. Biologic effects of dopamine on tumor vasculature in ovarian carcinoma. Neoplasia 15, 502-10 (2013). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 23633922

• Gene Symbol: GNAS
• Official Gene Full Name: GNAS complex locus
• Alias Symbols: AHO, C20orf45, GNAS1, GPSA, GSA, GSP, MGC33735, PHP1A, PHP1B, POH, dJ309F20.1.1, dJ806M20.3.3, NESP, PHP1C
• NCBI Gene Id: 2778
• Protein Name: Guanine nucleotide-binding protein G(s) subunit alpha isoforms short
• Description of Target: Mutations in GNAS gene result in pseudohypoparathyroidism type 1a, pseudohypoparathyroidism type 1b, Albright hereditary osteodystrophy, pseudopseudohypoparathyroidism, McCune-Albright syndrome, progressive osseus heteroplasia, polyostotic fibrous dysplasia of bone, and some pituitary tumors. This locus has a highly complex imprinted expression pattern. It gives rise to maternally, paternally, and biallelically expressed transcripts that are derived from four alternative promoters and 5' exons. Some transcripts contains a differentially methylated region (DMR) at their 5' exons, and this DMR is commonly found in imprinted genes and correlates with transcript expression. An antisense transcript exists, and this antisense transcript and one of the transcripts are paternally expressed, produce noncoding RNAs, and may regulate imprinting in this region. In addition, one of the transcripts contains a second overlapping ORF, which encodes a structurally unrelated protein - Alex. Alternative splicing of downstream exons is also observed, which results in different forms of the stimulatory G-protein alpha subunit, a key element of the classical signal transduction pathway linking receptor-ligand interactions with the activation of adenylyl cyclase and a variety of cellular reponses. Multiple transcript variants have been found for this gene, but the full-length nature and/or biological validity of some variants have not been determined. Mutations in this gene result in pseudohypoparathyroidism type 1a, pseudohypoparathyroidism type 1b, Albright hereditary osteodystrophy, pseudopseudohypoparathyroidism, McCune-Albright syndrome, progressive osseus heteroplasia, polyostotic fibrous dysplasia of bone, and some pituitary tumors.
• Swissprot Id: P63092
• Protein Accession #: NP_000507
• Nucleotide Accession #: NM_000516
• Protein Size (# AA): 394
• Molecular Weight: 46kDa
• RNA Seq: Find tissues and cell lines supported by RNA-seq analysis to express GNAS.
• Protein Interactions: PANX1; AXIN1; UBC; FUS; OPTN; PTGIR; HLA-A; ADRB2; NUCB2; NUCB1; LAMTOR1; SLC25A12; GNAQ; GNA11; UBD; TBXA2R; GNB1; AVPR2; SUMO1; PCK1; Ric8b; GNG2; CALM1; Haus1; Trim69; Cbx1; RIC8A; TTC1; SNX13; ADCY5; CRHR1; PTGDR; TSHR; CAV3; HTR6; RGS2; ADCY6; VIPR1;

Protocol:

• Reconstitution Instructions
• Immunohistochemistry (IHC) Protocol
• Immunocytochemistry (ICC) Protocol
• Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
• Western Blotting/Immunoblotting (WB/IB) Protocol
• Blocking Peptide Competition Protocol (BPCP)
• Immunoprecipitation (IP) Protocol

Tips Information:

• IHC Tips & Tricks
• ICC Tips & Tricks
• ELISA Tips & Tricks
• WB/IB Tips & Tricks
• IP Tips & Tricks

See our General FAQ page.

Product Protocols: GNAS antibody tested by IHC with human pancreas (arp42693)

Product Review: GNAS antibody - N-terminal region (ARP42693_P050) in INS1 lysate using Western Blot