Search Antibody, Protein, and ELISA Kit Solutions

GNAO1 Antibody - middle region : FITC (ARP55425_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP55425_P050 Unconjugated

ARP55425_P050-HRP Conjugated

ARP55425_P050-Biotin Conjugated

Gene Symbol:
GNAO1
Official Gene Full Name:
Guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O
NCBI Gene Id:
2775
Protein Name:
cDNA FLJ31446 fis, clone NT2NE2000909, highly similar to Guanine nucleotide-binding protein G(o) subunit alpha 1 EMBL BAG51601.1
Swissprot Id:
B3KP89
Protein Accession #:
NP_620073
Nucleotide Accession #:
NM_138736
Alias Symbols:
DKFZp686O0962, G-ALPHA-o, GNAO
Replacement Item:
This antibody may replace item sc-12798 from Santa Cruz Biotechnology.
Description of Target:
Activated Goalpha interacted directly with PLZF, and enhanced its function as a transcriptional and cell growth suppressor. Goalpha might play a role in mediating extracellular signal-regulated kinase activation by G protein-coupled receptors in the brain.
Protein Size (# AA):
354
Molecular Weight:
40kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GNAO1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GNAO1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human GNAO1
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Yeast: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-GNAO1 (ARP55425_P050)
Peptide Sequence:
Synthetic peptide located within the following region: CDVVSRMEDTEPFSAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
UBC; ADRA2A; BAG3; Htt; RGS9; GABBR1; Haus4; RGS1; RIC8A; DCTN2; KLHL3; SCN8A; PDE6G; CRHR1; GPSM2; HRH4; NGB; S1PR5; RGS19; GRM6; FFAR2; TSHR; RGS5; RGS10; RGS7; RGS4; RGS16; RGS14; PTPRU; CCR5; NUCB1; PDE6H; CACNA1B; OPRM1; OPRD1; GNAO1; GNAI1; ADRA2C;
Blocking Peptide:
For anti-GNAO1 (ARP55425_P050-FITC) antibody is Catalog # AAP55425 (Previous Catalog # AAPP33317)
Datasheets/Manuals:
Printable datasheet for anti-GNAO1 (ARP55425_P050-FITC) antibody
Sample Type Confirmation:

There is BioGPS gene expression data showing that GNAO1 is expressed in 721_B

Subunit:
alpha
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:
Won,J.H., (2008) Cell. Signal. 20 (5), 884-891

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...