Search Antibody, Protein, and ELISA Kit Solutions

GNAI3 Antibody - N-terminal region (ARP58905_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP58905_P050-FITC Conjugated

ARP58905_P050-HRP Conjugated

ARP58905_P050-Biotin Conjugated

Gene Symbol:
GNAI3
Official Gene Full Name:
Guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3
NCBI Gene Id:
2773
Protein Name:
Guanine nucleotide-binding protein G(k) subunit alpha
Swissprot Id:
P08754
Protein Accession #:
NP_006487
Nucleotide Accession #:
NM_006496
Alias Symbols:
87U6, FLJ26559
Replacement Item:
This antibody may replace item sc-12798 from Santa Cruz Biotechnology.
Description of Target:
GNAI3 is a guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. G(k) is the stimulatory G protein of receptor-regulated K+ channels.
Protein Size (# AA):
354
Molecular Weight:
39kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GNAI3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GNAI3.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human GNAI3
Predicted Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Goat: 85%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Sheep: 93%; Zebrafish: 100%
Complete computational species homology data:
Anti-GNAI3 (ARP58905_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ESGKSTIVKQMKIIHEDGYSEDECKQYKVVVYSNTIQSIIAIIRAMGRLK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
RGS17; RGS19; UBC; CCDC88C; GPSM3; SUMO2; GNB3; TXNDC5; UBFD1; YWHAQ; BZW1; PGD; LDHB; LDHA; EIF5; CAPNS1; XPO1; VCL; YWHAH; ESR1; BAG3; ADRB2; PAN2; RGS14; RANGAP1; NUCB2; NUCB1; NCF2; MTNR1A; FN1; ATP12A; SOX30; CDV3; GNB1; GNAI2; GNAI1; CD55; CCNT1; GN
Blocking Peptide:
For anti-GNAI3 (ARP58905_P050) antibody is Catalog # AAP58905 (Previous Catalog # AAPP44852)
Datasheets/Manuals:
Printable datasheet for anti-GNAI3 (ARP58905_P050) antibody
Subunit:
alpha

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...