Search Antibody, Protein, and ELISA Kit Solutions

GNAI3 Antibody - N-terminal region (ARP58905_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP58905_P050-FITC Conjugated

ARP58905_P050-HRP Conjugated

ARP58905_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-12798 from Santa Cruz Biotechnology.
The immunogen is a synthetic peptide directed towards the N terminal region of human GNAI3
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Goat: 85%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Sheep: 93%; Zebrafish: 100%
Complete computational species homology data:
Anti-GNAI3 (ARP58905_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ESGKSTIVKQMKIIHEDGYSEDECKQYKVVVYSNTIQSIIAIIRAMGRLK
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-GNAI3 (ARP58905_P050) antibody is Catalog # AAP58905 (Previous Catalog # AAPP44852)
Printable datasheet for anti-GNAI3 (ARP58905_P050) antibody
Gene Symbol:
Official Gene Full Name:
Guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3
Alias Symbols:
87U6, FLJ26559
NCBI Gene Id:
Protein Name:
Guanine nucleotide-binding protein G(k) subunit alpha
Description of Target:
GNAI3 is a guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. G(k) is the stimulatory G protein of receptor-regulated K+ channels.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GNAI3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GNAI3.
Protein Interactions:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...