Search Antibody, Protein, and ELISA Kit Solutions

GNAI2 Antibody - C-terminal region (ARP54632_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP54632_P050-FITC Conjugated

ARP54632_P050-HRP Conjugated

ARP54632_P050-Biotin Conjugated

Gene Symbol:
GNAI2
Official Gene Full Name:
Guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2
NCBI Gene Id:
2771
Protein Name:
Guanine nucleotide-binding protein G(i) subunit alpha-2
Swissprot Id:
P04899
Protein Accession #:
NP_002061
Nucleotide Accession #:
NM_002070
Alias Symbols:
GIP, GNAI2B, H_LUCA15.1, H_LUCA16.1
Replacement Item:
This antibody may replace item sc-12798 from Santa Cruz Biotechnology.
Description of Target:
Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. The G(i) proteins are involved in hormonal regulation of adenylate cyclase: they inhibit the cyclase in response to beta-adrenergic stimuli.
Protein Size (# AA):
355
Molecular Weight:
40kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GNAI2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GNAI2.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human GNAI2
Predicted Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Tested Species Reactivity:
Human, Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 93%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-GNAI2 (ARP54632_P050)
Peptide Sequence:
Synthetic peptide located within the following region: EYTGANKYDEAASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
NOTCH2NL; KRTAP10-8; KRT40; GPSM3; RGS20; UBC; TRIP6; MDFI; KRT31; SUMO2; RNF2; GCLM; GDI1; NAGK; SCRN1; LTB4R; ESR1; ATP4A; Rgs13; RGS3; PAN2; NPM1; NCF2; MTNR1A; HSP90AB1; HSP90AA1; CFTR; MYH10; GNB1; GNAI3; GNAI1; CYSTM1; ERGIC1; CORO1C; DHX30; SRSF1;
Blocking Peptide:
For anti-GNAI2 (ARP54632_P050) antibody is Catalog # AAP54632 (Previous Catalog # AAPP31423)
Datasheets/Manuals:
Printable datasheet for anti-GNAI2 (ARP54632_P050) antibody
Subunit:
alpha-2
Target Reference:
Bushfield,M., J. Cell. Sci. 120 (PT 13), 2171-2178 (2007)

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...