Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

GNAI1 Antibody - middle region (ARP54630_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP54630_P050-FITC Conjugated

ARP54630_P050-HRP Conjugated

ARP54630_P050-Biotin Conjugated

Gene Symbol:
GNAI1
Official Gene Full Name:
Guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1
NCBI Gene Id:
2770
Protein Name:
Guanine nucleotide-binding protein G(i) subunit alpha-1
Swissprot Id:
P63096
Protein Accession #:
NP_002060
Nucleotide Accession #:
NM_002069
Alias Symbols:
Gi
Replacement Item:
This antibody may replace item sc-105382 from Santa Cruz Biotechnology.
Description of Target:
Guanine nucleotide-binding proteins (G proteins) form a large family of signal-transducing molecules. They are found as heterotrimers made up of alpha, beta, and gamma subunits. Members of the G protein family have been characterized most extensively on the basis of the alpha subunit, which binds guanine nucleotide, is capable of hydrolyzing GTP, and interacts with specific receptor and effector molecules. The G protein family includes Gs and Gi, the stimulatory and inhibitory GTP-binding regulators of adenylate cyclase; Go, a protein abundant in brain (GNAO1); and transducin-1 (GNAT1) and transducin-2 (GNAT2), proteins involved in phototransduction in retinal rods and cones, respectively.Guanine nucleotide-binding proteins (G proteins) form a large family of signal-transducing molecules. They are found as heterotrimers made up of alpha, beta, and gamma subunits. Members of the G protein family have been characterized most extensively on the basis of the alpha subunit, which binds guanine nucleotide, is capable of hydrolyzing GTP, and interacts with specific receptor and effector molecules. The G protein family includes Gs (MIM 139320) and Gi, the stimulatory and inhibitory GTP-binding regulators of adenylate cyclase; Go, a protein abundant in brain (GNAO1; MIM 139311); and transducin-1 (GNAT1; MIM 139330) and transducin-2 (GNAT2; MIM 139340), proteins involved in phototransduction in retinal rods and cones, respectively (Sullivan et al., 1986 [PubMed 3092218]; Bray et al., 1987 [PubMed 3110783]). Suki et al. (1987) [PubMed 2440724] concluded that the human genome contains at least 3 nonallelic genes for alpha-i-type subunits of G protein; see, e.g, GNAI2 (MIM 139360), GNAI3 (MIM 139370), and GNAIH (MIM 139180).[supplied by OMIM]. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
354
Molecular Weight:
40kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GNAI1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GNAI1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human GNAI1
Predicted Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Yeast, Zebrafish
Tested Species Reactivity:
Human, Mouse, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Goat: 79%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 79%; Yeast: 100%; Zebrafish: 85%
Complete computational species homology data:
Anti-GNAI1 (ARP54630_P050)
Peptide Sequence:
Synthetic peptide located within the following region: YQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLH
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
GPSM3; RGS17; ESR1; ATP4A; RAD52; SVIL; NUCB1; NCF2; MTNR1B; MTNR1A; NCF1; THAP7; RIC8A; RGS14; IQCB1; UBC; RANGAP1; GPR50; GNB1; GNAI3; GNAI2; GNB4; GNB2; PTH1R; PCK1; Haus1; Cep76; Haus4; Recql4; Trim69; Cbx1; PGR; STRN; KLHL3; ADCY5; RASD1; CRHR1; GPSM
Blocking Peptide:
For anti-GNAI1 (ARP54630_P050) antibody is Catalog # AAP54630 (Previous Catalog # AAPP31421)
Datasheets/Manuals:
Printable datasheet for anti-GNAI1 (ARP54630_P050) antibody
Subunit:
alpha-1
Target Reference:
Hurst,J.H., (2008) Cell. Signal. 20 (2), 381-389

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...