GNA13 Antibody - middle region (ARP85255_P050)

Catalog No: ARP85255_P050

Host: Rabbit
Target Name: GNA13
Sample Tissue: Human Thymus Tumor lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GNA13
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: APMAAQGMVETRVFLQYLPAIRALWADSGIQNAYDRRREFQLGESVKYFL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-GNA13 (ARP85255_P050) antibody is Catalog # AAP85255

Target Info

• Gene Symbol: GNA13
• Gene Full Name: guanine nucleotide binding protein (G protein), alpha 13
• Alias Symbols: G13
• NCBI Gene Id: 10672
• Protein Name: guanine nucleotide-binding protein subunit alpha-13
• Description of Target: Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. Activates effector molecule RhoA by binding and activating RhoGEFs (ARHGEF1/p115RhoGEF, ARHGEF11/PDZ-RhoGEF and ARHGEF12/LARG). GNA13-dependent Rho signaling subsequently regulates transcription factor AP-1 (activating protein-1) (By similarity). Promotes tumor cell invasion and metastasis by activating RhoA/ROCK signaling pathway. Inhibits CDH1-mediated cell adhesion in process independent from Rho activation.
• Uniprot ID: Q14344-2
• Protein Accession #: NP_001269354.1
• Nucleotide Accession #: NM_001282425.1
• Protein Size (# AA): 282
• Molecular Weight: 31 kDa