Size:100 ul
$289.00
In Stock
SKU
ARP64960_P050-FITC
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP64960_P050 Unconjugated

ARP64960_P050-HRP Conjugated

ARP64960_P050-Biotin Conjugated

GNA11 Antibody - N-terminal region : FITC (ARP64960_P050-FITC)

Catalog#: ARP64960_P050-FITC
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC (FAM): Excitation 495 nm/ Emission 520 nm
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Replacement ItemThis antibody may replace item sc-120367 from Santa Cruz Biotechnology.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%; Zebrafish: 86%
Complete computational species homology dataAnti-GNA11 (ARP64960_P050)
Peptide SequenceSynthetic peptide located within the following region: IIHGAGYSEEDKRGFTKLVYQNIFTAMQAMIRAMETLKILYKYEQNKANA
Concentration0.5 mg/ml
Blocking PeptideFor anti-GNA11 (ARP64960_P050-FITC) antibody is Catalog # AAP64960
Datasheets/ManualsPrintable datasheet for anti-GNA11 (ARP64960_P050-FITC) antibody
Subunitalpha-11
Gene SymbolGNA11
Official Gene Full NameGuanine nucleotide binding protein (G protein), alpha 11 (Gq class)
Alias SymbolsGNA-11
NCBI Gene Id2767
Protein NameGuanine nucleotide-binding protein subunit alpha-11
Description of TargetGuanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. Acts as an activator of phospholipase C.
Swissprot IdP43444
Protein Accession #NP_002058
Nucleotide Accession #NM_002067
Protein Size (# AA)359
Molecular Weight41kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express GNA11.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express GNA11.
Protein InteractionsUBC; TBXA2R; PLCB1; SLC9A3R1; Rgs13; RGS3; CFTR; GNB1; GNAS; RGS14; ELAVL1; TRPC3; PTGIR; EDNRB; TSHR; HTR2B; MTNR1A; KDR; HTR2A; EDNRA; CHRM2; BDKRB2; ADRB2; ADRA1B;
  1. What is the species homology for "GNA11 Antibody - N-terminal region : FITC (ARP64960_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "GNA11 Antibody - N-terminal region : FITC (ARP64960_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "GNA11 Antibody - N-terminal region : FITC (ARP64960_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "GNA11 Antibody - N-terminal region : FITC (ARP64960_P050-FITC)"?

    This target may also be called "GNA-11" in publications.

  5. What is the shipping cost for "GNA11 Antibody - N-terminal region : FITC (ARP64960_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "GNA11 Antibody - N-terminal region : FITC (ARP64960_P050-FITC)"?

    All Aviva products have been through vigorous validations and carry 100% satisfaction warranty.

  7. Can I get bulk pricing for "GNA11 Antibody - N-terminal region : FITC (ARP64960_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "41kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "GNA11 Antibody - N-terminal region : FITC (ARP64960_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "GNA11"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "GNA11"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "GNA11"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "GNA11"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "GNA11"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "GNA11"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:GNA11 Antibody - N-terminal region : FITC (ARP64960_P050-FITC)
Your Rating
Aviva Travel Grant
Aviva Tissue Tool
Aviva Validation Data
Aviva HIS tag Deal