Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP64960_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP64960_P050-FITC Conjugated

ARP64960_P050-HRP Conjugated

ARP64960_P050-Biotin Conjugated

GNA11 Antibody - N-terminal region (ARP64960_P050)

Catalog#: ARP64960_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human, Mouse
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-120367 from Santa Cruz Biotechnology.
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%; Zebrafish: 86%
Complete computational species homology data Anti-GNA11 (ARP64960_P050)
Peptide Sequence Synthetic peptide located within the following region: IIHGAGYSEEDKRGFTKLVYQNIFTAMQAMIRAMETLKILYKYEQNKANA
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-GNA11 (ARP64960_P050) antibody is Catalog # AAP64960
Datasheets/Manuals Printable datasheet for anti-GNA11 (ARP64960_P050) antibody
Subunit alpha-11
Gene Symbol GNA11
Official Gene Full Name Guanine nucleotide binding protein (G protein), alpha 11 (Gq class)
Alias Symbols GNA-11
NCBI Gene Id 2767
Protein Name Guanine nucleotide-binding protein subunit alpha-11
Description of Target Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. Acts as an activator of phospholipase C.
Swissprot Id P43444
Protein Accession # NP_002058
Nucleotide Accession # NM_002067
Protein Size (# AA) 359
Molecular Weight 41kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express GNA11.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express GNA11.
Protein Interactions UBC; TBXA2R; PLCB1; SLC9A3R1; Rgs13; RGS3; CFTR; GNB1; GNAS; RGS14; ELAVL1; TRPC3; PTGIR; EDNRB; TSHR; HTR2B; MTNR1A; KDR; HTR2A; EDNRA; CHRM2; BDKRB2; ADRB2; ADRA1B;
Write Your Own Review
You're reviewing:GNA11 Antibody - N-terminal region (ARP64960_P050)
Your Rating