GM2S-1 Recombinant Protein (Soybean) (OPCA02882)

Catalog No: OPCA02882

GM2S-1 Recombinant Protein (Glycine max) (OPCA02882) in SDS-PAGE showing the molecular weight of approximately 18.1 kDa.

Product Info

• Predicted Species Reactivity: Glycine max
• Product Format: Liquid or Lyophilized powder
• Host: Glycine max
• Additional Information: Relevance: This is a 2S seed storage protein.
• Reconstitution and Storage: -20°C or -80°C
• Formulation: 20 mM Tris-HCl based buffer, pH 8.0
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDDNHILRTMRGRINYIRRNEGKDEDEEEEGHMQKCCTEMSELRSPKCQCKALQKIMENQSEELEEKQKKKMEKELINLATMCRFGPMIQCDLSSDD
• Protein Sequence: SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDDNHILRTMRGRINYIRRNEGKDEDEEEEGHMQKCCTEMSELRSPKCQCKALQKIMENQSEELEEKQKKKMEKELINLATMCRFGPMIQCDLSSDD
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Yeast
• Protein Range: 22-158 aa
• Tag: N-terminal 6xHis-tagged

Target Info

• Reference: A soybean cDNA encoding a chromatin-binding peptide inhibits mitosis of mammalian cells.Galvez A.F., de Lumen B.O.Nat. Biotechnol. 17:495-500(1999)
• Gene Symbol: GM2S-1
• Gene Full Name: 2S albumin
• Alias Symbols: 2S albumin;GLYMA_13G288100;GM2S-1;lunasin;napin-type 2S albumin 3.
• NCBI Gene Id: 548076
• Protein Name: 2S albumin
• Description of Target: This is a 2S seed storage protein.
• Uniprot ID: P19594
• Protein Accession #: NP_001238443.1
  
• Nucleotide Accession #: NM_001251514.1
• Protein Size (# AA): Recombinant
• Molecular Weight: 18.2 kDa