- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for GluR1 Antibody (Phospho-Ser849) (OAAF07716) |
---|
Predicted Species Reactivity | Human|Mouse|Rat |
---|---|
Clonality | Polyclonal |
Host | Rabbit |
Application | Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin |
Additional Information | Modification Sites: Human:S849 Mouse:S849 Rat:S849 |
Reconstitution and Storage | -20°C |
Immunogen | The antiserum was produced against synthesized peptide derived from human GluR1 around the phosphorylation site of Ser849. |
Purification | The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide. |
Peptide Sequence | Synthetic peptide located within the following region: GLGLAMLVALIEFCYKSRSESKRMKGFCLIPQQSINEAIRTSTLPRNSGA |
Concentration | 1mg/ml |
Specificity | GluR1 (Phospho-Ser849) Antibody detects endogenous levels of GluR1 only when phosphorylated at Ser849. |
Formulation | Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. |
Application Info | IHC: 1:50~1:100 ELISA: 1:40000 |
Gene Symbol | GRIA1 |
---|---|
Gene Full Name | glutamate ionotropic receptor AMPA type subunit 1 |
Alias Symbols | AMPA 1;AMPA-selective glutamate receptor 1;GluA1;GLUH1;gluR-1;GLUR1;gluR-A;GLURA;gluR-K1;glutamate receptor 1;Glutamate receptor ionotropic, AMPA 1;glutamate receptor, ionotropic, AMPA 1;HBGR1. |
NCBI Gene Id | 2890 |
Protein Name | Glutamate receptor 1 |
Description of Target | Ionotropic glutamate receptor. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. Binding of the excitatory neurotransmitter L-glutamate induces a conformation change, leading to the opening of the cation channel, and thereby converts the chemical signal to an electrical impulse. The receptor then desensitizes rapidly and enters a transient inactive state, characterized by the presence of bound agonist. In the presence of CACNG4 or CACNG7 or CACNG8, shows resensitization which is characterized by a delayed accumulation of current flux upon continued application of glutamate. |
Uniprot ID | P42261 |
Molecular Weight | 101 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "GluR1 Antibody (Phospho-Ser849) (OAAF07716)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human|Mouse|Rat".
-
How long will it take to receive "GluR1 Antibody (Phospho-Ser849) (OAAF07716)"?
This item is available "Domestic: within 1-2 week delivery | International: 1-2 weeks".
-
What buffer format is "GluR1 Antibody (Phospho-Ser849) (OAAF07716)" provided in?
This item is provided in "".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "GluR1 Antibody (Phospho-Ser849) (OAAF07716)"?
This target may also be called "AMPA 1;AMPA-selective glutamate receptor 1;GluA1;GLUH1;gluR-1;GLUR1;gluR-A;GLURA;gluR-K1;glutamate receptor 1;Glutamate receptor ionotropic, AMPA 1;glutamate receptor, ionotropic, AMPA 1;HBGR1." in publications.
-
What is the shipping cost for "GluR1 Antibody (Phospho-Ser849) (OAAF07716)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "GluR1 Antibody (Phospho-Ser849) (OAAF07716)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "GluR1 Antibody (Phospho-Ser849) (OAAF07716)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "101 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "GluR1 Antibody (Phospho-Ser849) (OAAF07716)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "GRIA1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "GRIA1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "GRIA1"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "GRIA1"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "GRIA1"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "GRIA1"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.