GluR1 Antibody (Phospho-Ser849) (OAAF07716)

Catalog No: OAAF07716 (Formerly GWB-ASB682)

Size:100 ug

Immunohistochemistry analysis of paraffin-embedded human brain, using GluR1 (Phospho-Ser849) Antibody. The picture on the right is blocked with the phospho peptide.

Product Info

• Predicted Species Reactivity: Human|Mouse|Rat
• Clonality: Polyclonal
• Host: Rabbit
• Application: Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin
• Additional Information: Modification Sites: Human:S849 Mouse:S849 Rat:S849
• Reconstitution and Storage: -20°C
• Immunogen: The antiserum was produced against synthesized peptide derived from human GluR1 around the phosphorylation site of Ser849.
• Purification: The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
• Peptide Sequence: Synthetic peptide located within the following region: GLGLAMLVALIEFCYKSRSESKRMKGFCLIPQQSINEAIRTSTLPRNSGA
• Concentration: 1mg/ml
• Specificity: GluR1 (Phospho-Ser849) Antibody detects endogenous levels of GluR1 only when phosphorylated at Ser849.
• Formulation: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
• Application Info:
  IHC: 1:50~1:100
  ELISA: 1:40000

Target Info

• Gene Symbol: GRIA1
• Gene Full Name: glutamate ionotropic receptor AMPA type subunit 1
• Alias Symbols: AMPA 1;AMPA-selective glutamate receptor 1;GluA1;GLUH1;gluR-1;GLUR1;gluR-A;GLURA;gluR-K1;glutamate receptor 1;Glutamate receptor ionotropic, AMPA 1;glutamate receptor, ionotropic, AMPA 1;HBGR1.
• NCBI Gene Id: 2890
• Protein Name: Glutamate receptor 1
• Description of Target: Ionotropic glutamate receptor. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. Binding of the excitatory neurotransmitter L-glutamate induces a conformation change, leading to the opening of the cation channel, and thereby converts the chemical signal to an electrical impulse. The receptor then desensitizes rapidly and enters a transient inactive state, characterized by the presence of bound agonist. In the presence of CACNG4 or CACNG7 or CACNG8, shows resensitization which is characterized by a delayed accumulation of current flux upon continued application of glutamate.
• Uniprot ID: P42261
• Molecular Weight: 101 kDa