SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP54827_P050
Price: $0.00
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-GLUD2 (ARP54827_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human GLUD2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%
Peptide SequenceSynthetic peptide located within the following region: MYRYLAKALLPSRAGPAALGSAANHSAALLGRGRGQPAAASQPGLALAAR
Concentration0.5 mg/ml
Blocking PeptideFor anti-GLUD2 (ARP54827_P050) antibody is Catalog # AAP54827 (Previous Catalog # AAPP31631)
ReferenceKanavouras,K., (2007) J. Neurosci. Res. 85 (15), 3398-3406
Gene SymbolGLUD2
Gene Full NameGlutamate dehydrogenase 2
Alias SymbolsGDH2, GLUDP1
NCBI Gene Id2747
Protein NameGlutamate dehydrogenase 2, mitochondrial
Description of TargetGlutamate dehydrogenase (EC catalyzes the reversible oxidative deamination of glutamate to alpha-ketoglutarate using NAD and/or NADP as cofactors.Glutamate dehydrogenase (EC catalyzes the reversible oxidative deamination of glutamate to alpha-ketoglutarate using NAD and/or NADP as cofactors. See also GLUD1 (MIM 138130).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-2348 BC050732.2 1-2348
Uniprot IDP49448
Protein Accession #NP_036216
Nucleotide Accession #NM_012084
Protein Size (# AA)558
Molecular Weight61kDa
Protein InteractionsRNF2; UBC; ATF2; TOM1L1; GLUD2;
  1. What is the species homology for "GLUD2 Antibody - N-terminal region (ARP54827_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "GLUD2 Antibody - N-terminal region (ARP54827_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "GLUD2 Antibody - N-terminal region (ARP54827_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "GLUD2 Antibody - N-terminal region (ARP54827_P050)"?

    This target may also be called "GDH2, GLUDP1" in publications.

  5. What is the shipping cost for "GLUD2 Antibody - N-terminal region (ARP54827_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "GLUD2 Antibody - N-terminal region (ARP54827_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "GLUD2 Antibody - N-terminal region (ARP54827_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "61kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "GLUD2 Antibody - N-terminal region (ARP54827_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "GLUD2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "GLUD2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "GLUD2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "GLUD2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "GLUD2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "GLUD2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:GLUD2 Antibody - N-terminal region (ARP54827_P050)
Your Rating
We found other products you might like!