Search Antibody, Protein, and ELISA Kit Solutions

GLUD1 antibody - N-terminal region (ARP45709_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP45709_P050-FITC Conjugated

ARP45709_P050-HRP Conjugated

ARP45709_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Glutamate dehydrogenase 1
Protein Name:
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
GDH, GDH1, GLUD, MGC132003
Replacement Item:
This antibody may replace item sc-115824 from Santa Cruz Biotechnology.
Description of Target:
L-glutamate dehydrogenase (EC has a central role in nitrogen metabolism in plants and animals. Glutamate dehydrogenase is found in all organisms and catalyzes the oxidative deamination of 1-glutamate to 2-oxoglutarate. Glutamate, the main substrate of GLUD, is present in brain in concentrations higher than in other organs. In nervous tissue, GLUD appears to function in both the synthesis and the catabolism of glutamate and perhaps in ammonia detoxification.L-glutamate dehydrogenase (EC has a central role in nitrogen metabolism in plants and animals. Glutamate dehydrogenase is found in all organisms and catalyzes the oxidative deamination of 1-glutamate to 2-oxoglutarate (Smith et al., 2001 [PubMed 11254391]). Glutamate, the main substrate of GLUD, is present in brain in concentrations higher than in other organs. In nervous tissue, GLUD appears to function in both the synthesis and the catabolism of glutamate and perhaps in ammonia detoxification (Mavrothalassitis et al., 1988 [PubMed 3368458]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-51 M20867.1 1-51 52-3120 BC112946.1 16-3084
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GLUD1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GLUD1.
The immunogen is a synthetic peptide directed towards the N terminal region of human GLUD1
Tested Species Reactivity:
Human, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 86%
Complete computational species homology data:
Anti-GLUD1 (ARP45709_P050)
Peptide Sequence:
Synthetic peptide located within the following region: AKAGVKINPKNYTDNELEKITRRFTMELAKKGFIGPGIDVPAPDMSTGER
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-GLUD1 (ARP45709_P050) antibody is Catalog # AAP45709 (Previous Catalog # AAPP11842)
Printable datasheet for anti-GLUD1 (ARP45709_P050) antibody
Sample Type Confirmation:

GLUD1 is supported by BioGPS gene expression data to be expressed in HEK293T

Additional Information:
IHC Information: Human Brain, Cortex: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Information: Colon, myenteric plexus
IHC Information: Human Pancreas: Formalin-Fixed, Paraffin-Embedded (FFPE)
Target Reference:
Kawajiri,M., (2006) Pediatr. Res. 59 (3), 359-364

Spanaki, C; Kotzamani, D; Petraki, Z; Drakos, E; Plaitakis, A; Expression of human GLUD1 and GLUD2 glutamate dehydrogenases in steroid producing tissues. 415, 1-11 (2015). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish 26241911

Spanaki, C; Kotzamani, D; Plaitakis, A; Widening Spectrum of Cellular and Subcellular Expression of Human GLUD1 and GLUD2 Glutamate Dehydrogenases Suggests Novel Functions. 42, 92-107 (2017). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish 27422263

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...