Size:100 ul
Special Price $229.00 Regular Price $319.00
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP45709_P050-FITC Conjugated

ARP45709_P050-HRP Conjugated

ARP45709_P050-Biotin Conjugated

More Information
Tested Species Reactivity Human, Rat
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Additional Information IHC Information: Human Brain, Cortex: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Information: Colon, myenteric plexus
IHC Information: Human Pancreas: Formalin-Fixed, Paraffin-Embedded (FFPE)
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-115824 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human GLUD1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 86%
Complete computational species homology data Anti-GLUD1 (ARP45709_P050)
Peptide Sequence Synthetic peptide located within the following region: AKAGVKINPKNYTDNELEKITRRFTMELAKKGFIGPGIDVPAPDMSTGER
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-GLUD1 (ARP45709_P050) antibody is Catalog # AAP45709 (Previous Catalog # AAPP11842)
Datasheets/Manuals Printable datasheet for anti-GLUD1 (ARP45709_P050) antibody
Sample Type Confirmation

GLUD1 is supported by BioGPS gene expression data to be expressed in HEK293T

Target Reference Kawajiri,M., (2006) Pediatr. Res. 59 (3), 359-364

Spanaki, C; Kotzamani, D; Petraki, Z; Drakos, E; Plaitakis, A; Expression of human GLUD1 and GLUD2 glutamate dehydrogenases in steroid producing tissues. 415, 1-11 (2015). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish 26241911

Spanaki, C; Kotzamani, D; Plaitakis, A; Widening Spectrum of Cellular and Subcellular Expression of Human GLUD1 and GLUD2 Glutamate Dehydrogenases Suggests Novel Functions. 42, 92-107 (2017). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish 27422263

Gene Symbol GLUD1
Official Gene Full Name Glutamate dehydrogenase 1
Alias Symbols GDH, GDH1, GLUD, MGC132003
NCBI Gene Id 2746
Protein Name Lengsin
Description of Target L-glutamate dehydrogenase (EC has a central role in nitrogen metabolism in plants and animals. Glutamate dehydrogenase is found in all organisms and catalyzes the oxidative deamination of 1-glutamate to 2-oxoglutarate. Glutamate, the main substrate of GLUD, is present in brain in concentrations higher than in other organs. In nervous tissue, GLUD appears to function in both the synthesis and the catabolism of glutamate and perhaps in ammonia detoxification.L-glutamate dehydrogenase (EC has a central role in nitrogen metabolism in plants and animals. Glutamate dehydrogenase is found in all organisms and catalyzes the oxidative deamination of 1-glutamate to 2-oxoglutarate (Smith et al., 2001 [PubMed 11254391]). Glutamate, the main substrate of GLUD, is present in brain in concentrations higher than in other organs. In nervous tissue, GLUD appears to function in both the synthesis and the catabolism of glutamate and perhaps in ammonia detoxification (Mavrothalassitis et al., 1988 [PubMed 3368458]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-51 M20867.1 1-51 52-3120 BC112946.1 16-3084
Swissprot Id Q5TDP6
Protein Accession # NP_005262
Nucleotide Accession # NM_005271
Protein Size (# AA) 558
Molecular Weight 56kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express GLUD1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express GLUD1.
  1. What is the species homology for "GLUD1 Antibody - N-terminal region (ARP45709_P050)"?

    The tested species reactivity for this item is "Human, Rat". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish".

  2. How long will it take to receive "GLUD1 Antibody - N-terminal region (ARP45709_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "GLUD1 Antibody - N-terminal region (ARP45709_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "GLUD1 Antibody - N-terminal region (ARP45709_P050)"?

    This target may also be called "GDH, GDH1, GLUD, MGC132003" in publications.

  5. What is the shipping cost for "GLUD1 Antibody - N-terminal region (ARP45709_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "GLUD1 Antibody - N-terminal region (ARP45709_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "GLUD1 Antibody - N-terminal region (ARP45709_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "56kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "GLUD1 Antibody - N-terminal region (ARP45709_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "GLUD1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "GLUD1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "GLUD1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "GLUD1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "GLUD1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "GLUD1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:GLUD1 Antibody - N-terminal region (ARP45709_P050)
Your Rating