Search Antibody, Protein, and ELISA Kit Solutions

GLS2 antibody - middle region (ARP43562_T100)

100 ul
$249.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP43562_T100-FITC Conjugated

ARP43562_T100-HRP Conjugated

ARP43562_T100-Biotin Conjugated

Gene Symbol:
GLS2
NCBI Gene Id:
27165
Official Gene Full Name:
Glutaminase 2 (liver, mitochondrial)
Protein Name:
Glutaminase liver isoform, mitochondrial
Swissprot Id:
Q9UI32
Protein Accession #:
EAW96942
Nucleotide Accession #:
NM_013267
Alias Symbols:
GA, GLS, LGA, MGC71567, hLGA
Replacement Item:
This antibody may replace item sc-168424 from Santa Cruz Biotechnology.
Description of Target:
GLS2 is a mitochondrial phosphate-activated glutaminase that catalyzes the hydrolysis of glutamine to stoichiometric amounts of glutamate and ammonia. This protein is functionally similar to the kidney glutaminase but is a little smaller in size. Originally thought to be liver-specific, this protein has been found in other tissues as well.
Protein Size (# AA):
327
Molecular Weight:
36kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GLS2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GLS2.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human GLS2
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 79%
Complete computational species homology data:
Anti-GLS2 (ARP43562_T100)
Peptide Sequence:
Synthetic peptide located within the following region: FVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDF
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
SNTA1; GRHPR; TAX1BP3; PAG1; DLG2; INADL; DLG4; RGS3; DLG1; DLG3; CASK;
Blocking Peptide:
For anti-GLS2 (ARP43562_T100) antibody is Catalog # AAP43562 (Previous Catalog # AAPP25007)
Datasheets/Manuals:
Printable datasheet for anti-GLS2 (ARP43562_T100) antibody
Sample Type Confirmation:

GLS2 is supported by BioGPS gene expression data to be expressed in HepG2

Additional Information:
IHC Information: HepG2 cell lysate. Antibody concentration: 2.5 ug/ml. Gel concentration: 12%.
Publications:

Toriumi, K. et al. Prenatal NMDA receptor antagonism impaired proliferation of neuronal progenitor, leading to fewer glutamatergic neurons in the prefrontal cortex. Neuropsychopharmacology 37, 1387-96 (2012). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 22257896

Hu, Z. et al. Quantitative liver-specific protein fingerprint in blood: a signature for hepatotoxicity. Theranostics 4, 215-28 (2014). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 24465277

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...