Search Antibody, Protein, and ELISA Kit Solutions

GLS2 Antibody - middle region (ARP43562_T100)

100 ul
$249.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP43562_T100-FITC Conjugated

ARP43562_T100-HRP Conjugated

ARP43562_T100-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
IHC, WB
Additional Information:
IHC Information: HepG2 cell lysate. Antibody concentration: 2.5 ug/ml. Gel concentration: 12%.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-168424 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human GLS2
Purification:
Protein A purified
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 79%
Complete computational species homology data:
Anti-GLS2 (ARP43562_T100)
Peptide Sequence:
Synthetic peptide located within the following region: FVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDF
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-GLS2 (ARP43562_T100) antibody is Catalog # AAP43562 (Previous Catalog # AAPP25007)
Datasheets/Manuals:
Printable datasheet for anti-GLS2 (ARP43562_T100) antibody
Sample Type Confirmation:

GLS2 is supported by BioGPS gene expression data to be expressed in HepG2

Publications:

Hu, Z. et al. Quantitative liver-specific protein fingerprint in blood: a signature for hepatotoxicity. Theranostics 4, 215-28 (2014). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 24465277

Toriumi, K. et al. Prenatal NMDA receptor antagonism impaired proliferation of neuronal progenitor, leading to fewer glutamatergic neurons in the prefrontal cortex. Neuropsychopharmacology 37, 1387-96 (2012). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 22257896

Gene Symbol:
GLS2
Official Gene Full Name:
Glutaminase 2 (liver, mitochondrial)
Alias Symbols:
GA, GLS, LGA, MGC71567, hLGA
NCBI Gene Id:
27165
Protein Name:
Glutaminase liver isoform, mitochondrial
Description of Target:
GLS2 is a mitochondrial phosphate-activated glutaminase that catalyzes the hydrolysis of glutamine to stoichiometric amounts of glutamate and ammonia. This protein is functionally similar to the kidney glutaminase but is a little smaller in size. Originally thought to be liver-specific, this protein has been found in other tissues as well.
Swissprot Id:
Q9UI32
Protein Accession #:
EAW96942
Nucleotide Accession #:
NM_013267
Protein Size (# AA):
327
Molecular Weight:
36kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GLS2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GLS2.
Protein Interactions:
SNTA1; GRHPR; TAX1BP3; PAG1; DLG2; INADL; DLG4; RGS3; DLG1; DLG3; CASK;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...