Search Antibody, Protein, and ELISA Kit Solutions

GLS2 Antibody - middle region (ARP43562_T100)

100 ul
$249.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP43562_T100-FITC Conjugated

ARP43562_T100-HRP Conjugated

ARP43562_T100-Biotin Conjugated

Gene Symbol:
GLS2
Official Gene Full Name:
Glutaminase 2 (liver, mitochondrial)
NCBI Gene Id:
27165
Protein Name:
Glutaminase liver isoform, mitochondrial
Swissprot Id:
Q9UI32
Protein Accession #:
EAW96942
Nucleotide Accession #:
NM_013267
Alias Symbols:
GA, GLS, LGA, MGC71567, hLGA
Replacement Item:
This antibody may replace item sc-168424 from Santa Cruz Biotechnology.
Description of Target:
GLS2 is a mitochondrial phosphate-activated glutaminase that catalyzes the hydrolysis of glutamine to stoichiometric amounts of glutamate and ammonia. This protein is functionally similar to the kidney glutaminase but is a little smaller in size. Originally thought to be liver-specific, this protein has been found in other tissues as well.
Protein Size (# AA):
327
Molecular Weight:
36kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GLS2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GLS2.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human GLS2
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 79%
Complete computational species homology data:
Anti-GLS2 (ARP43562_T100)
Peptide Sequence:
Synthetic peptide located within the following region: FVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDF
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
SNTA1; GRHPR; TAX1BP3; PAG1; DLG2; INADL; DLG4; RGS3; DLG1; DLG3; CASK;
Blocking Peptide:
For anti-GLS2 (ARP43562_T100) antibody is Catalog # AAP43562 (Previous Catalog # AAPP25007)
Datasheets/Manuals:
Printable datasheet for anti-GLS2 (ARP43562_T100) antibody
Sample Type Confirmation:

GLS2 is supported by BioGPS gene expression data to be expressed in HepG2

Additional Information:
IHC Information: HepG2 cell lysate. Antibody concentration: 2.5 ug/ml. Gel concentration: 12%.
Publications:

Hu, Z. et al. Quantitative liver-specific protein fingerprint in blood: a signature for hepatotoxicity. Theranostics 4, 215-28 (2014). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 24465277

Toriumi, K. et al. Prenatal NMDA receptor antagonism impaired proliferation of neuronal progenitor, leading to fewer glutamatergic neurons in the prefrontal cortex. Neuropsychopharmacology 37, 1387-96 (2012). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 22257896

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...