Size:100 ul
$249.00
In stock
SKU
ARP43562_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP43562_T100-FITC Conjugated

ARP43562_T100-HRP Conjugated

ARP43562_T100-Biotin Conjugated

GLS2 Antibody - middle region (ARP43562_T100)

Catalog#: ARP43562_T100
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Additional InformationIHC Information: HepG2 cell lysate. Antibody concentration: 2.5 ug/ml. Gel concentration: 12%.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-168424 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human GLS2
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 79%
Complete computational species homology dataAnti-GLS2 (ARP43562_T100)
Peptide SequenceSynthetic peptide located within the following region: FVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDF
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-GLS2 (ARP43562_T100) antibody is Catalog # AAP43562 (Previous Catalog # AAPP25007)
Datasheets/ManualsPrintable datasheet for anti-GLS2 (ARP43562_T100) antibody
Sample Type Confirmation

GLS2 is supported by BioGPS gene expression data to be expressed in HepG2

Publications

Hu, Z. et al. Quantitative liver-specific protein fingerprint in blood: a signature for hepatotoxicity. Theranostics 4, 215-28 (2014). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 24465277

Toriumi, K. et al. Prenatal NMDA receptor antagonism impaired proliferation of neuronal progenitor, leading to fewer glutamatergic neurons in the prefrontal cortex. Neuropsychopharmacology 37, 1387-96 (2012). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 22257896

Gene SymbolGLS2
Official Gene Full NameGlutaminase 2 (liver, mitochondrial)
Alias SymbolsGA, GLS, LGA, MGC71567, hLGA
NCBI Gene Id27165
Protein NameGlutaminase liver isoform, mitochondrial
Description of TargetGLS2 is a mitochondrial phosphate-activated glutaminase that catalyzes the hydrolysis of glutamine to stoichiometric amounts of glutamate and ammonia. This protein is functionally similar to the kidney glutaminase but is a little smaller in size. Originally thought to be liver-specific, this protein has been found in other tissues as well.
Swissprot IdQ9UI32
Protein Accession #EAW96942
Nucleotide Accession #NM_013267
Protein Size (# AA)327
Molecular Weight36kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express GLS2.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express GLS2.
Protein InteractionsSNTA1; GRHPR; TAX1BP3; PAG1; DLG2; INADL; DLG4; RGS3; DLG1; DLG3; CASK;
Write Your Own Review
You're reviewing:GLS2 Antibody - middle region (ARP43562_T100)
Your Rating
Aviva Tips and Tricks
Aviva Live Chat
Aviva Blast Tool
Aviva Tissue Tool