SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP55098_P050
Price: $0.00
SKU
ARP55098_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-GLS (ARP55098_P050) antibody
Product Info
Tested Species ReactivityHuman, Rat
Predicted Species ReactivityHuman, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the c terminal region of human GLS
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 86%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 100%; Rat: 93%
Peptide SequenceSynthetic peptide located within the following region: VNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQT
Concentration0.5 mg/ml
Blocking PeptideFor anti-GLS (ARP55098_P050) antibody is Catalog # AAP55098 (Previous Catalog # AAPP32716)
Sample Type Confirmation

GLS is strongly supported by BioGPS gene expression data to be expressed in ACHN

ReferenceSahai (1983) [PubMed 6825316]
Publications

Glutamine fuels proliferation but not migration of endothelial cells. EMBO J. 36, 2321-2333 (2017). 28659379

Gene SymbolGLS
Gene Full NameGlutaminase
Alias SymbolsGAC, GAM, KGA, GLS1, AAD20, DEE71, GDPAG, CASGID, EIEE71
NCBI Gene Id2744
Protein NameGlutaminase kidney isoform, mitochondrial
Description of TargetSahai (1983) [PubMed 6825316] demonstrated phosphate-activated glutaminase (EC 3.5.1.2) in human platelets. It is the major enzyme yielding glutamate from glutamine. Significance of the enzyme derives from its possible implication in behavior disturbances
Uniprot IDO94925
Protein Accession #NP_055720
Nucleotide Accession #NM_014905
Protein Size (# AA)669
Molecular Weight73kDa
Protein InteractionsUBC; PEPD; MVD; GNS; MYL12A; GDA; EIF5A; CAPN1; ATF2; ATXN10; CUL5; TAX1BP3; PARD6A; SNTA1;
  1. What is the species homology for "GLS Antibody - C-terminal region (ARP55098_P050)"?

    The tested species reactivity for this item is "Human, Rat". This antibody is predicted to have homology to "Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "GLS Antibody - C-terminal region (ARP55098_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "GLS Antibody - C-terminal region (ARP55098_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "GLS Antibody - C-terminal region (ARP55098_P050)"?

    This target may also be called "GAC, GAM, KGA, GLS1, AAD20, DEE71, GDPAG, CASGID, EIEE71" in publications.

  5. What is the shipping cost for "GLS Antibody - C-terminal region (ARP55098_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "GLS Antibody - C-terminal region (ARP55098_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "GLS Antibody - C-terminal region (ARP55098_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "73kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "GLS Antibody - C-terminal region (ARP55098_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "GLS"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "GLS"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "GLS"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "GLS"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "GLS"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "GLS"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:GLS Antibody - C-terminal region (ARP55098_P050)
Your Rating
We found other products you might like!