Catalog No: OPCA04453
Price: $0.00
SKU
OPCA04453
Availability: Domestic: Antibody & Kits: 2 weeks | Proteins: 4-6 weeks | International: Antibody & Kits: 2 weeks | Proteins: 4-6 weeks
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for GLPE Recombinant Protein (Escherichia coli) (OPCA04453) (OPCA04453) |
---|
Predicted Species Reactivity | Escherichia coli |
---|---|
Product Format | Liquid or Lyophilized powder |
Additional Information | Species Specificity Detail: Escherichia coli (strain K12) |
Reconstitution and Storage | -20°C or -80°C |
Formulation | Tris-base, 50% glycerol |
Purity | Greater than 90% as determined by SDS-PAGE. |
Peptide Sequence | MDQFECINVADAHQKLQEKEAVLVDIRDPQSFAMGHAVQAFHLTNDTLGAFMRDNDFDTPVMVMCYHGNSSKGAAQYLLQQGYDVVYSIDGGFEVWQRQFPAEVAYGA |
Protein Sequence | MDQFECINVADAHQKLQEKEAVLVDIRDPQSFAMGHAVQAFHLTNDTLGAFMRDNDFDTPVMVMCYHGNSSKGAAQYLLQQGYDVVYSIDGGFEVWQRQFPAEVAYGA |
Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Source | Yeast |
Protein Range | 1-108 aa |
Tag | N-terminal 6xHis-tagged |
Reference | Complete sequence of Escherichia coli C str. ATCC 8739.Copeland A., Lucas S., Lapidus A., Glavina del Rio T., Dalin E., Tice H., Bruce D., Goodwin L., Pitluck S., Kiss H., Brettin T., Detter J.C., Han C., Kuske C.R., Schmutz J., Larimer F., Land M., Hauser L. Richardson P.Submitted (FEB-2008) |
Gene Symbol | GLPE |
---|---|
Alias Symbols | glpE, EcolC_0289, Thiosulfate sulfurtransferase GlpE, EC 2.8.1.1 |
Protein Name | Thiosulfate sulfurtransferase GlpE |
Description of Target | Catalyzes, although with low efficiency, the sulfur transfer reaction from thiosulfate to cyanide. |
Uniprot ID | B1IP41 |
Protein Accession # | WP_000371929 |
Nucleotide Accession # | NC_010468 |
Protein Size (# AA) | Recombinant |
Molecular Weight | 14.1 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
Write Your Own Review