$0.00
In stock
SKU
OPCA289327
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Globin-F1 Recombinant Protein (Inshore hagfish) (OPCA289327)

Catalog#: OPCA289327
Domestic: within 4-6 weeks delivery International: 4-6 weeks
More Information
Predicted Species Reactivity Inshore hagfish
Product Format Liquid
Host E. coli, yeast, insect, or mammalian cell can be selected above to determine price.
Application WB, ELISA
Additional Information For Research Use Only.
Sterile filtering available upon request.
Low endotoxin available upon request.
Reconstitution and Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Purity Greater than 85% as determined by SDS-PAGE.
Protein Sequence PIIDQGPLPTLTDGDKKAINKIWPKIYKEYEQYSLNILLRFLKCFPQAQASFPKFSTKKSNLEQDPEVKHQAVVIFNKVNEIINSMDNQEEIIKSLKDLSQKHKTVFKVDSIWFKELSSIFVSTIDGGAEFEKLFSIICILLRSAY
Storage Buffer Tris-based buffer,50% glycerol
Tag This protein may contain a N-terminal tag or C-terminal tag based on protein stability requirements.
Datasheets/Manuals Printable datasheet for OPCA289327
Protein Name Globin-F1
Swissprot Id Q7SID0
Protein Size (# AA) 146
Write Your Own Review
You're reviewing:Globin-F1 Recombinant Protein (Inshore hagfish) (OPCA289327)
Your Rating