Size:100 ul
$319.00
In Stock
SKU
ARP30037_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP30037_P050-FITC Conjugated

ARP30037_P050-HRP Conjugated

ARP30037_P050-Biotin Conjugated

More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-133625 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human GLIS2
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data Anti-GLIS2 (ARP30037_P050)
Peptide Sequence Synthetic peptide located within the following region: QDLVDHVNDYHVKPEKDAGYCCHWEGCARHGRGFNARYKMLIHIRTHTNE
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-GLIS2 (ARP30037_P050) antibody is Catalog # AAP30037 (Previous Catalog # AAPH00213)
Datasheets/Manuals Printable datasheet for anti-GLIS2 (ARP30037_P050) antibody
Target Reference Zhang,F., et al., (2002) J. Biol. Chem. 277 (12), 10139-10149
Publications

Attanasio, M. et al. Loss of GLIS2 causes nephronophthisis in humans and mice by increased apoptosis and fibrosis. Nat. Genet. 39, 1018-24 (2007). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 17618285

Gene Symbol GLIS2
Official Gene Full Name GLIS family zinc finger 2
Alias Symbols NKL, NPHP7
NCBI Gene Id 84662
Protein Name Zinc finger protein GLIS2
Description of Target Members of the Kruppel-like zinc finger protein family, such as GLIS2, function as activators and/or repressors of gene transcription.
Swissprot Id Q9BZE0
Protein Accession # NP_115964
Nucleotide Accession # NM_032575
Protein Size (# AA) 524
Molecular Weight 56kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express GLIS2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express GLIS2.
Protein Interactions TRIM32; UBC; PML; BBS2; BBS1; WNK1; XAB2; GPSM2; CPSF1; RBFOX2; SPECC1L; U2AF2; CTNNB1;
  1. What is the species homology for "GLIS2 Antibody - N-terminal region (ARP30037_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "GLIS2 Antibody - N-terminal region (ARP30037_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "GLIS2 Antibody - N-terminal region (ARP30037_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "GLIS2 Antibody - N-terminal region (ARP30037_P050)"?

    This target may also be called "NKL, NPHP7" in publications.

  5. What is the shipping cost for "GLIS2 Antibody - N-terminal region (ARP30037_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "GLIS2 Antibody - N-terminal region (ARP30037_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "GLIS2 Antibody - N-terminal region (ARP30037_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "56kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "GLIS2 Antibody - N-terminal region (ARP30037_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "GLIS2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "GLIS2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "GLIS2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "GLIS2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "GLIS2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "GLIS2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:GLIS2 Antibody - N-terminal region (ARP30037_P050)
Your Rating
We found other products you might like!