Size:100 ul
$319.00
In stock
SKU
ARP30037_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP30037_P050-FITC Conjugated

ARP30037_P050-HRP Conjugated

ARP30037_P050-Biotin Conjugated

More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-133625 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human GLIS2
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data Anti-GLIS2 (ARP30037_P050)
Peptide Sequence Synthetic peptide located within the following region: QDLVDHVNDYHVKPEKDAGYCCHWEGCARHGRGFNARYKMLIHIRTHTNE
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-GLIS2 (ARP30037_P050) antibody is Catalog # AAP30037 (Previous Catalog # AAPH00213)
Datasheets/Manuals Printable datasheet for anti-GLIS2 (ARP30037_P050) antibody
Target Reference Zhang,F., et al., (2002) J. Biol. Chem. 277 (12), 10139-10149
Publications

Attanasio, M. et al. Loss of GLIS2 causes nephronophthisis in humans and mice by increased apoptosis and fibrosis. Nat. Genet. 39, 1018-24 (2007). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 17618285

Gene Symbol GLIS2
Official Gene Full Name GLIS family zinc finger 2
Alias Symbols NKL, NPHP7
NCBI Gene Id 84662
Protein Name Zinc finger protein GLIS2
Description of Target Members of the Kruppel-like zinc finger protein family, such as GLIS2, function as activators and/or repressors of gene transcription.
Swissprot Id Q9BZE0
Protein Accession # NP_115964
Nucleotide Accession # NM_032575
Protein Size (# AA) 524
Molecular Weight 56kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express GLIS2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express GLIS2.
Protein Interactions TRIM32; UBC; PML; BBS2; BBS1; WNK1; XAB2; GPSM2; CPSF1; RBFOX2; SPECC1L; U2AF2; CTNNB1;
Write Your Own Review
You're reviewing:GLIS2 Antibody - N-terminal region (ARP30037_P050)
Your Rating