Aviva Systems Biology office will be closed for Good Friday - April 19, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

GLIS2 Antibody - N-terminal region (ARP30037_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP30037_P050-FITC Conjugated

ARP30037_P050-HRP Conjugated

ARP30037_P050-Biotin Conjugated

Gene Symbol:
GLIS2
Official Gene Full Name:
GLIS family zinc finger 2
NCBI Gene Id:
84662
Protein Name:
Zinc finger protein GLIS2
Swissprot Id:
Q9BZE0
Protein Accession #:
NP_115964
Nucleotide Accession #:
NM_032575
Alias Symbols:
NKL, NPHP7
Replacement Item:
This antibody may replace item sc-133625 from Santa Cruz Biotechnology.
Description of Target:
Members of the Kruppel-like zinc finger protein family, such as GLIS2, function as activators and/or repressors of gene transcription.
Protein Size (# AA):
524
Molecular Weight:
56kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GLIS2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GLIS2.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human GLIS2
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-GLIS2 (ARP30037_P050)
Peptide Sequence:
Synthetic peptide located within the following region: QDLVDHVNDYHVKPEKDAGYCCHWEGCARHGRGFNARYKMLIHIRTHTNE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
TRIM32; UBC; PML; BBS2; BBS1; WNK1; XAB2; GPSM2; CPSF1; RBFOX2; SPECC1L; U2AF2; CTNNB1;
Blocking Peptide:
For anti-GLIS2 (ARP30037_P050) antibody is Catalog # AAP30037 (Previous Catalog # AAPH00213)
Datasheets/Manuals:
Printable datasheet for anti-GLIS2 (ARP30037_P050) antibody
Target Reference:
Zhang,F., et al., (2002) J. Biol. Chem. 277 (12), 10139-10149
Publications:

Attanasio, M. et al. Loss of GLIS2 causes nephronophthisis in humans and mice by increased apoptosis and fibrosis. Nat. Genet. 39, 1018-24 (2007). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 17618285

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...