Aviva Systems Biology office will be closed for Christmas and New Year Holiday - December 24-25, 2018 and January 1, 2019.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

GLIS2 antibody - N-terminal region (ARP30036_T100)

100 ul
In Stock

Conjugation Options

ARP30036_T100-FITC Conjugated

ARP30036_T100-HRP Conjugated

ARP30036_T100-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
GLIS family zinc finger 2
Protein Name:
Zinc finger protein GLIS2
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-133625 from Santa Cruz Biotechnology.
Description of Target:
Members of the Kruppel-like zinc finger protein family, such as GLIS2, function as activators and/or repressors of gene transcription.[supplied by OMIM].
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GLIS2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GLIS2.
The immunogen is a synthetic peptide directed towards the N terminal region of human GLIS2
Species Reactivity:
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Dog: 92%; Guinea Pig: 86%; Horse: 77%; Human: 100%; Mouse: 83%; Rabbit: 85%; Rat: 92%
Complete computational species homology data:
Anti-GLIS2 (ARP30036_T100)
Peptide Sequence:
Synthetic peptide located within the following region: LSPPSGLDSPNGSSSLSPERQGNGDLPPVPSASDFQPLRYLDGVPSSFQF
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-GLIS2 (ARP30036_T100) antibody is Catalog # AAP30036 (Previous Catalog # AAPH00212)
Printable datasheet for anti-GLIS2 (ARP30036_T100) antibody
Target Reference:
Kim,Y.S., et al., (2003) Nucleic Acids Res. 31 (19), 5513-5525

Tell us what you think about this item!

Write A Review
    Please, wait...