Catalog No: OPCA04284
Price: $0.00
SKU
OPCA04284
Availability: Domestic: Antibody & Kits: 2 weeks | Proteins: 4-6 weeks | International: Antibody & Kits: 2 weeks | Proteins: 4-6 weeks
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for GLI2 Recombinant Protein (Human) (OPCA04284) (OPCA04284) |
---|
Predicted Species Reactivity | Homo sapiens|Human |
---|---|
Product Format | Liquid or Lyophilized powder |
Additional Information | Species Specificity Detail: Homo sapiens (Human) |
Reconstitution and Storage | -20°C or -80°C |
Formulation | Tris-base, 50% glycerol |
Purity | Greater than 90% as determined by SDS-PAGE. |
Peptide Sequence | EQLADLKEDLDRDDCKQEAEVVIYETNCHWEDCTKEYDTQEQLVHHINNEHIHGEKKEFVCRWQACTREQKPFKAQYMLVVHMRRHTGEKPHKCTFEGCSKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTHSNEKPYICKIPGCTKRYTDPSSLRKHVKTVHGPDAHVTKKQRNDVHLRTPLLKENGDSEAGTEPGGPESTEASSTSQAVEDCL |
Protein Sequence | EQLADLKEDLDRDDCKQEAEVVIYETNCHWEDCTKEYDTQEQLVHHINNEHIHGEKKEFVCRWQACTREQKPFKAQYMLVVHMRRHTGEKPHKCTFEGCSKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTHSNEKPYICKIPGCTKRYTDPSSLRKHVKTVHGPDAHVTKKQRNDVHLRTPLLKENGDSEAGTEPGGPESTEASSTSQAVEDCL |
Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Source | Yeast |
Protein Range | 412-641 aa |
Tag | N-terminal 6xHis-tagged |
Reference | Generation and annotation of the DNA sequences of human chromosomes 2 and 4.Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) |
Gene Symbol | GLI2 |
---|---|
Gene Full Name | GLI family zinc finger 2 |
Alias Symbols | CJS;GLI family zinc finger protein 2;GLI-Kruppel family member GLI2;glioma-associated oncogene family zinc finger 2;HPE9;oncogene GLI2;PHS2;Tax helper protein;tax helper protein 1;tax helper protein 2;tax-responsive element-2 holding protein;tax-responsive element-25-bp sequence binding protein;THP1;THP2;zinc finger protein GLI2. |
NCBI Gene Id | 2736 |
Protein Name | Zinc finger protein GLI2 |
Description of Target | Functions as transcription regulator in the hedgehog (Hh) pathway (PubMed:18455992, PubMed:26565916). Functions as transcriptional activator (PubMed:9557682, PubMed:19878745, PubMed:24311597). May also function as transcriptional repressor (By similarity). Requires STK36 for full transcriptional activator activity. Required for normal embryonic development (PubMed:15994174, PubMed:20685856). |
Uniprot ID | P10070 |
Protein Accession # | NP_005261 |
Nucleotide Accession # | NM_005270 |
Protein Size (# AA) | Recombinant |
Molecular Weight | 28.5 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
Write Your Own Review
We found other products you might like!