- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
| Datasheets/Manuals | Printable datasheet for GLE1 Antibody (OAAL00123) |
|---|
| Predicted Species Reactivity | Human, Mouse |
|---|---|
| Product Format | Liquid |
| Clonality | Monoclonal |
| Clone | 1D8 |
| Isotype | IgG1 Kappa |
| Host | Mouse |
| Application | Enzyme-linked immunosorbent assay|Immunofluorescence|Western blot |
| Reconstitution and Storage | Store at -20C or lower. Aliquot to avoid repeated freezing and thawing. |
| Immunogen | GLE1 (NP_001003722.1, 140 a.a. ~ 240 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Peptide Sequence | RMKGTEGLRLWQEEQERKVQALSEMASEQLKRFDEWKELKQHKEFQDLREVMEKSSREALGHQEKLKAEHRHRAKILNLKLREAEQQRVKQAEQERLRKEE |
| Formulation | In 1x PBS, pH 7.4 |
| Gene Symbol | GLE1 |
|---|---|
| Gene Full Name | GLE1 RNA export mediator |
| Alias Symbols | CAAHC;CAAHD;GLE1 RNA export mediator homolog;GLE1L;GLE1-like protein;GLE1-like, RNA export mediator;hGLE1;LCCS;LCCS1;nucleoporin GLE1. |
| NCBI Gene Id | 2733 |
| Protein Name | Homo sapiens GLE1, RNA export mediator (GLE1), transcript variant 1, mRNA|nucleoporin GLE1 isoform 1 [Homo sapiens] |
| Description of Target | This gene encodes a predicted 75-kDa polypeptide with high sequence and structure homology to yeast Gle1p, which is nuclear protein with a leucine-rich nuclear export sequence essential for poly(A)+RNA export. Inhibition of human GLE1L by microinjection of antibodies against GLE1L in HeLa cells resulted in inhibition of poly(A)+RNA export. Immunoflourescence studies show that GLE1L is localized at the nuclear pore complexes. This localization suggests that GLE1L may act at a terminal step in the export of mature RNA messages to the cytoplasm. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq |
| Protein Accession # | https://www.ncbi.nlm.nih.gov/protein/NP_001003722.1 |
| Nucleotide Accession # | https://www.ncbi.nlm.nih.gov/nuccore/NM_001003722 |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "GLE1 Antibody (OAAL00123)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse".
-
How long will it take to receive "GLE1 Antibody (OAAL00123)"?
This item is available "Domestic: within 2-3 week delivery | International: 2-3 weeks".
-
What buffer format is "GLE1 Antibody (OAAL00123)" provided in?
This item is provided in "Liquid".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "GLE1 Antibody (OAAL00123)"?
This target may also be called "CAAHC;CAAHD;GLE1 RNA export mediator homolog;GLE1L;GLE1-like protein;GLE1-like, RNA export mediator;hGLE1;LCCS;LCCS1;nucleoporin GLE1." in publications.
-
What is the shipping cost for "GLE1 Antibody (OAAL00123)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "GLE1 Antibody (OAAL00123)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "GLE1 Antibody (OAAL00123)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "GLE1 Antibody (OAAL00123)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "GLE1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "GLE1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "GLE1"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "GLE1"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "GLE1"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "GLE1"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.
