Catalog No: ARP54579_P050
Price: $0.00
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

GLE1 Antibody - N-terminal region (ARP54579_P050)

Datasheets/ManualsPrintable datasheet for anti-GLE1 (ARP54579_P050) antibody
Product Info
ReferenceNousiainen,H.O., (2008) Nat. Genet. 40 (2), 155-157
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Yeast, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human GLE1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 86%; Rabbit: 77%; Rat: 100%; Yeast: 90%; Zebrafish: 77%
Peptide SequenceSynthetic peptide located within the following region: LKLREAEQQRVKQAEQERLRKEEGQIRLRALYALQEEMLQLSQQLDASEQ
Concentration0.5 mg/ml
Blocking PeptideFor anti-GLE1 (ARP54579_P050) antibody is Catalog # AAP54579 (Previous Catalog # AAPP31363)
Gene SymbolGLE1
Gene Full NameGLE1 RNA export mediator homolog (yeast)
NCBI Gene Id2733
Protein NameNucleoporin GLE1
Description of TargetGLE1 is a predicted 75-kDa polypeptide with high sequence and structure homology to yeast Gle1p, which is nuclear protein with a leucine-rich nuclear export sequence essential for poly(A)+RNA export. Inhibition of human GLE1L by microinjection of antibodies against GLE1L in HeLa cells resulted in inhibition of poly(A)+RNA export. Immunoflourescence studies show that GLE1L is localized at the nuclear pore complexes. This localization suggests that GLE1L may act at a terminal step in the export of mature RNA messages to the cytoplasm.This gene encodes a predicted 75-kDa polypeptide with high sequence and structure homology to yeast Gle1p, which is nuclear protein with a leucine-rich nuclear export sequence essential for poly(A)+RNA export. Inhibition of human GLE1L by microinjection of antibodies against GLE1L in HeLa cells resulted in inhibition of poly(A)+RNA export. Immunoflourescence studies show that GLE1L is localized at the nuclear pore complexes. This localization suggests that GLE1L may act at a terminal step in the export of mature RNA messages to the cytoplasm. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Uniprot IDQ53GS7
Protein Accession #NP_001490
Nucleotide Accession #NM_001499
Protein Size (# AA)659
Molecular Weight75kDa
Protein InteractionsRNF2; UBC; ELAVL1; NUPL2; NUP155; EIF3F; UXT; KRT10;
  1. What is the species homology for "GLE1 Antibody - N-terminal region (ARP54579_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Yeast, Zebrafish".

  2. How long will it take to receive "GLE1 Antibody - N-terminal region (ARP54579_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "GLE1 Antibody - N-terminal region (ARP54579_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "GLE1 Antibody - N-terminal region (ARP54579_P050)"?

    This target may also be called "LCCS, CAAHC, CAAHD, GLE1L, LCCS1, hGLE1" in publications.

  5. What is the shipping cost for "GLE1 Antibody - N-terminal region (ARP54579_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "GLE1 Antibody - N-terminal region (ARP54579_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "GLE1 Antibody - N-terminal region (ARP54579_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "75kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "GLE1 Antibody - N-terminal region (ARP54579_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "GLE1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "GLE1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "GLE1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "GLE1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "GLE1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "GLE1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:GLE1 Antibody - N-terminal region (ARP54579_P050)
Your Rating
We found other products you might like!