Search Antibody, Protein, and ELISA Kit Solutions

GJC3 Antibody - middle region (ARP36639_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP36639_P050-FITC Conjugated

ARP36639_P050-HRP Conjugated

ARP36639_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Human
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
GJC3
Official Gene Full Name:
Gap junction protein, gamma 3, 30.2kDa
NCBI Gene Id:
349149
Protein Name:
Gap junction gamma-3 protein
Swissprot Id:
Q8NFK1
Protein Accession #:
NP_853516
Nucleotide Accession #:
NM_181538
Alias Symbols:
CX29, CX30.2, CX31.3, GJE1
Replacement Item:
This antibody may replace item sc-62136 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a gap junction protein. The encoded protein, also known as a connexin, plays a role in formation of gap junctions, which provide direct connections between neighboring cells. Mutations in this gene have been reported to be associated with nonsyndromic hearing loss.
Protein Size (# AA):
279
Molecular Weight:
31kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GJC3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GJC3.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human GJC3
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Complete computational species homology data:
Anti-GJC3 (ARP36639_P050)
Peptide Sequence:
Synthetic peptide located within the following region: WHWELSGKGKEEETLIQGREGNTDVPGAGSLRLLWAYVAQLGARLVLEGAA
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-GJC3 (ARP36639_P050) antibody is Catalog # AAP36639 (Previous Catalog # AAPS06303)
Datasheets/Manuals:
Printable datasheet for anti-GJC3 (ARP36639_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...