GJB1 Antibody - C-terminal region : HRP (ARP36600_T100-HRP)

Catalog No: ARP36600_T100-HRP

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: HRP: Horseradish Peroxidase
• Application: IHC, WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GJB1
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: GFGHRLSPEYKQNEINKLLSEQDGSLKDILRRSPGTGAGLAEKSDRCSAC
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-GJB1 (ARP36600_T100-HRP) antibody is Catalog # AAP36600 (Previous Catalog # AAPP07839)
• Reference: Dagli,M.L., et al., (2004) Carcinogenesis 25 (4), 483-492
• Publications:

  Hu, Z. et al. Quantitative liver-specific protein fingerprint in blood: a signature for hepatotoxicity. Theranostics 4, 215-28 (2014). WB, Dog, Pig, Rabbit, Rat, Bovine, Human, Mouse, Horse, Guinea pig 24465277

Target Info

• Gene Symbol: GJB1
• Gene Full Name: Gap junction protein, beta 1, 32kDa
• Alias Symbols: CMTX, CX32, CMTX1
• NCBI Gene Id: 2705
• Protein Name: Gap junction beta-1 protein
• Description of Target: This gene encodes for a Connexin 32 protein. A large Charcot-Marie-Tooth disease family has been identified with a novel mutation in the Cx32 P2 promoter region at position -526bp. Cx32 mutants that are associated with a CNS phenotype may have toxic effects in oligodendrocytes.
• Uniprot ID: P08034
• Protein Accession #: NP_000157
• Nucleotide Accession #: NM_000166
• Protein Size (# AA): 283
• Molecular Weight: 31kDa
• Protein Interactions: UBC; VKORC1; APP; CNST; OCLN; PRKACA; SRC; PRKCA; GJB2; CALM1; CAV1; JUP;