Size:100 ul
$249.00
In Stock
SKU
ARP36600_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP36600_T100-FITC Conjugated

ARP36600_T100-HRP Conjugated

ARP36600_T100-Biotin Conjugated

GJB1 Antibody - C-terminal region (ARP36600_T100)

Catalog#: ARP36600_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-174827 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human GJB1
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology dataAnti-GJB1 (ARP36600_T100)
Peptide SequenceSynthetic peptide located within the following region: GFGHRLSPEYKQNEINKLLSEQDGSLKDILRRSPGTGAGLAEKSDRCSAC
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-GJB1 (ARP36600_T100) antibody is Catalog # AAP36600 (Previous Catalog # AAPP07839)
Datasheets/ManualsPrintable datasheet for anti-GJB1 (ARP36600_T100) antibody
Target ReferenceDagli,M.L., et al., (2004) Carcinogenesis 25 (4), 483-492
Publications

Hu, Z. et al. Quantitative liver-specific protein fingerprint in blood: a signature for hepatotoxicity. Theranostics 4, 215-28 (2014). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 24465277

Gene SymbolGJB1
Official Gene Full NameGap junction protein, beta 1, 32kDa
Alias SymbolsCMTX, CX32, CMTX1
NCBI Gene Id2705
Protein NameGap junction beta-1 protein
Description of TargetThis gene encodes for a Connexin 32 protein. A large Charcot-Marie-Tooth disease family has been identified with a novel mutation in the Cx32 P2 promoter region at position -526bp. Cx32 mutants that are associated with a CNS phenotype may have toxic effects in oligodendrocytes.
Swissprot IdP08034
Protein Accession #NP_000157
Nucleotide Accession #NM_000166
Protein Size (# AA)283
Molecular Weight31kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express GJB1.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express GJB1.
Protein InteractionsUBC; VKORC1; APP; CNST; OCLN; PRKACA; SRC; PRKCA; GJB2; CALM1; CAV1; JUP;
Write Your Own Review
You're reviewing:GJB1 Antibody - C-terminal region (ARP36600_T100)
Your Rating
Aviva Tissue Tool
Aviva Validation Data
Aviva HIS tag Deal
Assay Development