Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

GJB1 Antibody - C-terminal region (ARP36600_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP36600_T100-FITC Conjugated

ARP36600_T100-HRP Conjugated

ARP36600_T100-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Gap junction protein, beta 1, 32kDa
NCBI Gene Id:
Protein Name:
Gap junction beta-1 protein
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-174827 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes for a Connexin 32 protein. A large Charcot-Marie-Tooth disease family has been identified with a novel mutation in the Cx32 P2 promoter region at position -526bp. Cx32 mutants that are associated with a CNS phenotype may have toxic effects in oligodendrocytes.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GJB1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GJB1.
The immunogen is a synthetic peptide directed towards the C terminal region of human GJB1
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Human, Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-GJB1 (ARP36600_T100)
Peptide Sequence:
Synthetic peptide located within the following region: GFGHRLSPEYKQNEINKLLSEQDGSLKDILRRSPGTGAGLAEKSDRCSAC
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-GJB1 (ARP36600_T100) antibody is Catalog # AAP36600 (Previous Catalog # AAPP07839)
Printable datasheet for anti-GJB1 (ARP36600_T100) antibody
Target Reference:
Dagli,M.L., et al., (2004) Carcinogenesis 25 (4), 483-492

Hu, Z. et al. Quantitative liver-specific protein fingerprint in blood: a signature for hepatotoxicity. Theranostics 4, 215-28 (2014). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 24465277

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...