Aviva Systems Biology office will be closed for Good Friday - April 19, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

GJA4 Antibody - middle region (ARP36603_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP36603_P050-FITC Conjugated

ARP36603_P050-HRP Conjugated

ARP36603_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Gap junction protein, alpha 4, 37kDa
NCBI Gene Id:
Protein Name:
Gap junction alpha-4 protein
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-117429 from Santa Cruz Biotechnology.
Description of Target:
GJA4 is a member of the connexin family. The protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. Mutations in this gene have been associated with atherosclerosis and a higher risk of myocardial infarction.This gene encodes a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. Mutations in this gene have been associated with atherosclerosis and a higher risk of myocardial infarction. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GJA4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GJA4.
The immunogen is a synthetic peptide directed towards the middle region of human GJA4
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 79%; Human: 100%; Mouse: 79%; Rabbit: 100%; Rat: 86%; Sheep: 93%
Complete computational species homology data:
Anti-GJA4 (ARP36603_P050)
Peptide Sequence:
Synthetic peptide located within the following region: QKEGELRALPAKDPQVERALAAVERQMAKISVAEDGRLRIRGALMGTYVA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-GJA4 (ARP36603_P050) antibody is Catalog # AAP36603 (Previous Catalog # AAPP07842)
Printable datasheet for anti-GJA4 (ARP36603_P050) antibody
Sample Type Confirmation:

GJA4 is strongly supported by BioGPS gene expression data to be expressed in 721_B

Target Reference:
Cepni,I., (2008) Fertil. Steril. 89 (2), 417-420

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...