Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP36597_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP36597_P050-FITC Conjugated

ARP36597_P050-HRP Conjugated

ARP36597_P050-Biotin Conjugated

GJA1 Antibody - middle region (ARP36597_P050)

Catalog#: ARP36597_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human, Rat
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-119391 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human GJA1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 100%; Rat: 93%
Complete computational species homology data Anti-GJA1 (ARP36597_P050)
Peptide Sequence Synthetic peptide located within the following region: GSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASS
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-GJA1 (ARP36597_P050) antibody is Catalog # AAP36597 (Previous Catalog # AAPP07836)
Datasheets/Manuals Printable datasheet for anti-GJA1 (ARP36597_P050) antibody
Target Reference Feller,L., (2008) Am. J. Med. Genet. A 146A (10), 1350-1353
Gene Symbol GJA1
Official Gene Full Name Gap junction protein, alpha 1, 43kDa
Alias Symbols CX43, DFNB38, GJAL, ODDD, HSS, AVSD3, HLHS1
NCBI Gene Id 2697
Protein Name Gap junction alpha-1 protein
Description of Target Gap junction protein, alpha 1 is a member of the connexin gene family and a component of gap junctions. Gap junctions are composed of arrays of intercellular channels and provide a route for the diffusion of materials of low molecular weight from cell to cell. Connexin 43 is the major protein of gap junctions in the heart, and gap junctions are thought to have a crucial role in the synchronized contraction of the heart and in embryonic development. Connexin 43 is targeted by several protein kinases that regulate myocardial cell-cell coupling. A related intron-less connexin 43 pseudogene, GJA1P, has been mapped to chromosome 5. This gene is a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. The encoded protein is the major protein of gap junctions in the heart that are thought to have a crucial role in the synchronized contraction of the heart and in embryonic development. A related intronless pseudogene has been mapped to chromosome 5. Mutations in this gene have been associated with oculodentodigital dysplasia and heart malformations. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id P17302
Protein Accession # NP_000156
Nucleotide Accession # NM_000165
Protein Size (# AA) 382
Molecular Weight 43kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express GJA1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express GJA1.
Protein Interactions UBC; STAMBP; EPS15; UBQLN4; PSMD4; PSMD2; S100A1; GJA1; CNST; NEDD4; TJP1; HGS; TSG101; SGSM3; GJA5; MAPK7; MAPK3; CAV1; CSNK1D; SRC; PRKCG; PRKCE; PRKCB; PRKCA; MAPK1; NOV; CSK; GJA3;
  1. What is the species homology for "GJA1 Antibody - middle region (ARP36597_P050)"?

    The tested species reactivity for this item is "Human, Rat". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat".

  2. How long will it take to receive "GJA1 Antibody - middle region (ARP36597_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "GJA1 Antibody - middle region (ARP36597_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "GJA1 Antibody - middle region (ARP36597_P050)"?

    This target may also be called "CX43, DFNB38, GJAL, ODDD, HSS, AVSD3, HLHS1" in publications.

  5. What is the shipping cost for "GJA1 Antibody - middle region (ARP36597_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "GJA1 Antibody - middle region (ARP36597_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "GJA1 Antibody - middle region (ARP36597_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "43kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "GJA1 Antibody - middle region (ARP36597_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "GJA1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "GJA1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "GJA1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "GJA1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "GJA1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "GJA1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:GJA1 Antibody - middle region (ARP36597_P050)
Your Rating
We found other products you might like!