Size:100 ul
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP73969_P050 Unconjugated

ARP73969_P050-HRP Conjugated

ARP73969_P050-Biotin Conjugated

GIGYF2 Antibody - N-terminal region : FITC (ARP73969_P050-FITC)

Catalog#: ARP73969_P050-FITC
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Clonality Polyclonal
Host Rabbit
Conjugation FITC (FAM): Excitation 495 nm/ Emission 520 nm
Application WB
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human PERQ2
Purification Affinity purified
Peptide Sequence Synthetic peptide located within the following region: LAGSRRDGERWRPHSPDGPRSAGWREHMERRRRFEFDFRDRDDERGYRRV
Concentration 0.5 mg/ml
Blocking Peptide For anti-GIGYF2 (ARP73969_P050-FITC) antibody is Catalog # AAP73969
Datasheets/Manuals Printable datasheet for anti-GIGYF2 (ARP73969_P050-FITC) antibody
Target Reference N/A
Gene Symbol GIGYF2
Official Gene Full Name GRB10 interacting GYF protein 2
Alias Symbols GYF2, PERQ2, PERQ3, PARK11, TNRC15
NCBI Gene Id 26058
Protein Name GRB10-interacting GYF protein 2
Description of Target This gene contains CAG trinucleotide repeats and encodes a protein containing several stretches of polyglutamine residues. The encoded protein may be involved in the regulation of tyrosine kinase receptor signaling. This gene is located in a chromosomal region that was genetically linked to Parkinson disease type 11, and mutations in this gene were thought to be causative for this disease. However, more recent studies in different populations have been unable to replicate this association. Alternative splicing results in multiple transcript variants.
Swissprot Id Q6Y7W6
Protein Accession # NP_056390
Protein Size (# AA) 1299
Molecular Weight 142kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express GIGYF2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express GIGYF2.
  1. What is the species homology for "GIGYF2 Antibody - N-terminal region : FITC (ARP73969_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "GIGYF2 Antibody - N-terminal region : FITC (ARP73969_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "GIGYF2 Antibody - N-terminal region : FITC (ARP73969_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact

  4. What are other names for "GIGYF2 Antibody - N-terminal region : FITC (ARP73969_P050-FITC)"?

    This target may also be called "GYF2, PERQ2, PERQ3, PARK11, TNRC15" in publications.

  5. What is the shipping cost for "GIGYF2 Antibody - N-terminal region : FITC (ARP73969_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "GIGYF2 Antibody - N-terminal region : FITC (ARP73969_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "GIGYF2 Antibody - N-terminal region : FITC (ARP73969_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "142kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "GIGYF2 Antibody - N-terminal region : FITC (ARP73969_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "GIGYF2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "GIGYF2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "GIGYF2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "GIGYF2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "GIGYF2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "GIGYF2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:GIGYF2 Antibody - N-terminal region : FITC (ARP73969_P050-FITC)
Your Rating
We found other products you might like!