Search Antibody, Protein, and ELISA Kit Solutions

GIGYF2 Antibody - N-terminal region : FITC (ARP73969_P050-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP73969_P050 Unconjugated

ARP73969_P050-HRP Conjugated

ARP73969_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
GIGYF2
Official Gene Full Name:
GRB10 interacting GYF protein 2
NCBI Gene Id:
26058
Protein Name:
GRB10-interacting GYF protein 2
Swissprot Id:
Q6Y7W6
Protein Accession #:
NP_056390
Alias Symbols:
GYF2, PERQ2, PERQ3, PARK11, TNRC15
Description of Target:
This gene contains CAG trinucleotide repeats and encodes a protein containing several stretches of polyglutamine residues. The encoded protein may be involved in the regulation of tyrosine kinase receptor signaling. This gene is located in a chromosomal region that was genetically linked to Parkinson disease type 11, and mutations in this gene were thought to be causative for this disease. However, more recent studies in different populations have been unable to replicate this association. Alternative splicing results in multiple transcript variants.
Protein Size (# AA):
1299
Molecular Weight:
142kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GIGYF2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GIGYF2.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human PERQ2
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: LAGSRRDGERWRPHSPDGPRSAGWREHMERRRRFEFDFRDRDDERGYRRV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
0.5 mg/ml
Protein Interactions:
HUWE1; AURKB; VCP; TP53; LGALS3BP; EMD; CDKN1A; AIRE; CEP76; CEP250; MAGED2; TUBGCP3; CEP57; UBC; LGR4; BMI1; RQCD1; YWHAB; GRB10; TARDBP; UBD; EIF4E2; HSP90AA1; ZNF598; DIS3L; SIRT7; PCK1; SUMO1; U2AF1L4; GEMIN4; AGO2; PABPC1; PRPF6; TNRC6B; U2AF2; DDX20
Blocking Peptide:
For anti-GIGYF2 (ARP73969_P050-FITC) antibody is Catalog # AAP73969
Datasheets/Manuals:
Printable datasheet for anti-GIGYF2 (ARP73969_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:
N/A

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...