SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP81632_P050
Price: $0.00
SKU
ARP81632_P050
Availability: Domestic: within 24 hours delivery | International: 3-5 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-GIGYF2 (ARP81632_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human GIGYF2
PurificationAffinity purified
Peptide SequenceSynthetic peptide located within the following region: GSRRDGERWRPHSPDGPRSAGWREHMERRRRFEFDFRDRDDERGYRRVRS
Concentration0.5 mg/ml
Blocking PeptideFor anti-GIGYF2 (ARP81632_P050) antibody is Catalog # AAP81632
Gene SymbolGIGYF2
Gene Full NameGRB10 interacting GYF protein 2
Alias SymbolsGYF2, PERQ2, PERQ3, PARK11, TNRC15
NCBI Gene Id26058
Protein NamePERQ amino acid-rich with GYF domain-containing protein 2
Description of TargetThis gene contains CAG trinucleotide repeats and encodes a protein containing several stretches of polyglutamine residues. The encoded protein may be involved in the regulation of tyrosine kinase receptor signaling. This gene is located in a chromosomal region that was genetically linked to Parkinson disease type 11, and mutations in this gene were thought to be causative for this disease. However, more recent studies in different populations have been unable to replicate this association. Alternative splicing results in multiple transcript variants.
Uniprot IDQ6Y7W6
Protein Accession #NP_001096616.1
Nucleotide Accession #NM_001103146.1
Protein Size (# AA)1299
Molecular Weight142 kDa
  1. What is the species homology for "GIGYF2 Antibody - middle region (ARP81632_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "GIGYF2 Antibody - middle region (ARP81632_P050)"?

    This item is available "Domestic: within 24 hours delivery | International: 3-5 days".

  3. What buffer format is "GIGYF2 Antibody - middle region (ARP81632_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "GIGYF2 Antibody - middle region (ARP81632_P050)"?

    This target may also be called "GYF2, PERQ2, PERQ3, PARK11, TNRC15" in publications.

  5. What is the shipping cost for "GIGYF2 Antibody - middle region (ARP81632_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "GIGYF2 Antibody - middle region (ARP81632_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "GIGYF2 Antibody - middle region (ARP81632_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "142 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "GIGYF2 Antibody - middle region (ARP81632_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "GIGYF2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "GIGYF2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "GIGYF2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "GIGYF2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "GIGYF2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "GIGYF2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:GIGYF2 Antibody - middle region (ARP81632_P050)
Your Rating
We found other products you might like!