SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP42013_T100
Price: $0.00
SKU
ARP42013_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-GH2 (ARP42013_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Goat, Horse, Pig, Rabbit, Sheep
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human GH2
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Peptide SequenceSynthetic peptide located within the following region: NQSYSKFDTKSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSC
Concentration1.0 mg/ml
Blocking PeptideFor anti-GH2 (ARP42013_T100) antibody is Catalog # AAP42013 (Previous Catalog # AAPS11506)
ReferenceLacroix,M.C., (2005) Endocrinology 146 (5), 2434-2444
Gene SymbolGH2
Gene Full NameGrowth hormone 2
Alias SymbolsGHL, GHV, GH-V, GHB2, hGH-V
NCBI Gene Id2689
Protein NameGrowth hormone variant
Description of TargetGH2 is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. Mutations in its gene lead to placental growth hormone/lactogen deficiency.The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. The gene, along with four other related genes, is located at the growth hormone locus on chromosome 17 where they are interspersed in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. The five genes share a remarkably high degree of sequence identity. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. As in the case of its pituitary counterpart, growth hormone 1, the predominant isoform of this particular family member shows similar somatogenic activity, with reduced lactogenic activity. Mutations in this gene lead to placental growth hormone/lactogen deficiency.
Uniprot IDO14643
Protein Accession #NP_072050
Nucleotide Accession #NM_022556
Protein Size (# AA)202
Molecular Weight22kDa
Protein InteractionsGHR;
  1. What is the species homology for "GH2 Antibody - middle region (ARP42013_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Goat, Horse, Pig, Rabbit, Sheep".

  2. How long will it take to receive "GH2 Antibody - middle region (ARP42013_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "GH2 Antibody - middle region (ARP42013_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "GH2 Antibody - middle region (ARP42013_T100)"?

    This target may also be called "GHL, GHV, GH-V, GHB2, hGH-V" in publications.

  5. What is the shipping cost for "GH2 Antibody - middle region (ARP42013_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "GH2 Antibody - middle region (ARP42013_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "GH2 Antibody - middle region (ARP42013_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "22kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "GH2 Antibody - middle region (ARP42013_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "GH2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "GH2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "GH2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "GH2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "GH2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "GH2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:GH2 Antibody - middle region (ARP42013_T100)
Your Rating
We found other products you might like!