Search Antibody, Protein, and ELISA Kit Solutions

GH1 Antibody - C-terminal region (ARP41762_P050)

100 ul

Regular Price: $319.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP41762_P050-FITC Conjugated

ARP41762_P050-HRP Conjugated

ARP41762_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Dog, Goat, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Growth hormone 1
NCBI Gene Id:
Protein Name:
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-10364 from Santa Cruz Biotechnology.
Description of Target:
The function of this protein remains unknown.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GH1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GH1.
Predicted Homology Based on Immunogen Sequence:
Dog: 85%; Goat: 83%; Guinea Pig: 85%; Human: 100%; Mouse: 85%; Rabbit: 85%; Rat: 85%; Sheep: 83%
Complete computational species homology data:
Anti-GH1 (ARP41762_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDA
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
Available upon request
Printable datasheet for anti-GH1 (ARP41762_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...