GGPS1 Antibody - middle region : Biotin (ARP48534_P050-Biotin)

Catalog No: ARP48534_P050-Biotin

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: Biotin
• Application: IHC, WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GGPS1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
• Peptide Sequence: Synthetic peptide located within the following region: LGLFFQIRDDYANLHSKEYSENKSFCEDLTEGKFSFPTIHAIWSRPESTQ
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-GGPS1 (ARP48534_P050-Biotin) antibody is Catalog # AAP48534 (Previous Catalog # AAPY01478)
• Sample Type Confirmation:

  GGPS1 is strongly supported by BioGPS gene expression data to be expressed in HEK293T

• Reference: Raz,T., (2007) Blood 110 (6), 2102-2109

Target Info

• Gene Symbol: GGPS1
• Gene Full Name: Geranylgeranyl diphosphate synthase 1
• Alias Symbols: GGPPS, GGPPS1
• NCBI Gene Id: 9453
• Protein Name: Geranylgeranyl pyrophosphate synthase
• Description of Target: GGPS1 is a member of the prenyltransferase family and has geranylgeranyl diphosphate (GGPP) synthase activity. The enzyme catalyzes the synthesis of GGPP from farnesyl diphosphate and isopentenyl diphosphate. GGPP is an important molecule responsible for the C20-prenylation of proteins and for the regulation of a nuclear hormone receptor. The protein is an important precursor of carotenoids and geranylated proteins. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.This gene is a member of the prenyltransferase family and encodes a protein with geranylgeranyl diphosphate (GGPP) synthase activity. The enzyme catalyzes the synthesis of GGPP from farnesyl diphosphate and isopentenyl diphosphate. GGPP is an important molecule responsible for the C20-prenylation of proteins and for the regulation of a nuclear hormone receptor. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
• Uniprot ID: O95749
• Protein Accession #: NP_001032354
• Nucleotide Accession #: NM_001037277
• Protein Size (# AA): 300
• Molecular Weight: 35kDa
• Protein Interactions: GGPS1; ATOX1; UBC;