GGN Antibody - N-terminal region : HRP (ARP53093_P050-HRP)

Catalog No: ARP53093_P050-HRP

Size:100ul

Click here to learn more about Aviva's By-Request Conjugation Service.

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit
• Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: HRP: Horseradish Peroxidase
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GGN
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: GPSKWQKPAGTPVPRIRRLLEASHRGQGDPPSLRPLKPPPPPRQLSVKDT
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-GGN (ARP53093_P050-HRP) antibody is Catalog # AAP53093 (Previous Catalog # AAPP35326)

Target Info

• Reference: Zhang,J., (2005) FEBS Lett. 579 (2), 559-566
• Gene Symbol: GGN
• Gene Full Name: Gametogenetin
• Alias Symbols: FLJ35713, MGC33369
• NCBI Gene Id: 199720
• Protein Name: Gametogenetin
• Description of Target: GGN may be involved in spermatogenesis.This gene is a germ cell-specific gene that encodes proteins that interact with POG (proliferation of germ cells). Alternatively spliced transcript variants of a similar mouse gene encode at least three different proteins, namely gametogenetin protein 1a, gametogenetin protein 2, and gametogenetin protein 3, which show a perinuclear, cytoplasmic, and nucleolar localization, respectively. These proteins regulate the localization of POG and may play a role in spermatogenesis.
• Uniprot ID: Q86UU5
• Protein Accession #: NP_689870
• Nucleotide Accession #: NM_152657
• Protein Size (# AA): 652
• Molecular Weight: 67kDa
• Protein Interactions: KRT40; ECT2; BRCA1; OAZ3; GGNBP2; GGN; FANCL;